BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0519.Seq (548 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 29 0.024 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 27 0.13 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 27 0.13 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 27 0.13 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 26 0.29 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 25 0.38 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 25 0.38 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 25 0.51 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 25 0.51 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 25 0.51 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 25 0.51 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 25 0.51 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 25 0.51 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 25 0.67 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 25 0.67 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 24 0.88 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 24 0.88 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 24 0.88 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 24 0.88 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 0.88 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 0.88 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 0.88 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 0.88 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 0.88 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 0.88 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 0.88 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 0.88 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 24 0.88 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 24 0.88 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 24 0.88 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 0.88 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 24 0.88 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 23 1.5 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 23 1.5 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 23 1.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 1.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 2.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 2.7 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 2.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 2.7 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 4.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.7 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.7 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 6.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 6.2 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 6.2 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 29.5 bits (63), Expect = 0.024 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 4/101 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR+ Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERE 74 Query: 120 GS-ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 S E K + S + N ++N + + +Y T KK++ Sbjct: 75 RSKEPKIISNNNSLSNNYNYNNNYN--NYNNNYNTNYKKLQ 113 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 70 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 71 -TERERSKEPKIISNNNSLSNNYN 93 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 70 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 71 -TERERSKEPKIISNNNSLSNNYN 93 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 70 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 71 -TERERSKEPKIISNNNSLSNNYN 93 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 70 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 71 -TERERSKEPKIISNNNSLSNNYN 93 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 70 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 71 -TERERSKEPKIISNNNSLSNNYN 93 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 70 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 71 -TERERSKEPKIISNNNSLSNNYN 93 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 70 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 71 -TERERSKEPKIISNNNSLSNNYN 93 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 70 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 71 -TERERSKEPKIISNNNSLSNNYN 93 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 248 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 303 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 304 -TERERSKEPKIISNNNSLSNNYN 326 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 27.1 bits (57), Expect = 0.13 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR Sbjct: 248 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNR---- 303 Query: 120 GSERKSSGKDEEYSEQNSSNKSFN 49 +ER+ S + + S NS + ++N Sbjct: 304 -TERERSKEPKIISNNNSLSNNYN 326 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 25.8 bits (54), Expect = 0.29 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 4/86 (4%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 121 +DR + NE K S+ + RE+ + K++ K E+S R +NR+ Sbjct: 15 KDRQYEKLHNEKEKFLEERTSRKRYSRSREREQKLYKNKREYRKYRETSKERSRNRTERE 74 Query: 120 GS-ERKSSGKDEEYSEQNSSNKSFND 46 S E K + S + N ++N+ Sbjct: 75 RSKEPKIISNNNPLSNNYNYNNNYNN 100 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 25.4 bits (53), Expect = 0.38 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 7/89 (7%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRTERE 74 Query: 126 NSGSER--KSSGKDEEYSEQNSSNKSFND 46 S + S + YS N+ N ++N+ Sbjct: 75 RSREPKIISSLSNNYNYSNYNNYNNNYNN 103 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.38 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -3 Query: 219 EREKSESNKKSREFEN-KEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 49 ERE+ +S K RE+ +E +RD+ S + S + N++ K++N Sbjct: 277 EREQ-KSYKNEREYRKYRETSKERFRDRRERERSKESKIISSLSNKTIHNNNNYKNYN 333 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.51 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = -3 Query: 318 RKGY*R*IFRDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK 139 RK Y R R+R Q +NE+S R K+ R+++E ++S+E + + S+ Y Sbjct: 36 RKRYSR--SREREQKSYKNENSYRKYRKTSKERSRDRTE-RERSKEPKIISSLSNNYNYS 92 Query: 138 NRSVNS 121 N + N+ Sbjct: 93 NYNNNN 98 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.51 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = -3 Query: 318 RKGY*R*IFRDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK 139 RK Y R R+R Q +NE+S R K+ R+++E ++S+E + + S+ Y Sbjct: 36 RKRYSR--SREREQKSYKNENSYRKYRKTSKERSRDRTE-RERSKEPKIISSLSNNYNYS 92 Query: 138 NRSVNS 121 N + N+ Sbjct: 93 NYNNNN 98 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.51 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = -3 Query: 318 RKGY*R*IFRDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK 139 RK Y R R+R Q +NE+S R K+ R+++E ++S+E + + S+ Y Sbjct: 36 RKRYSR--SREREQKSYKNENSYRKYRKTSKERSRDRTE-RERSKEPKIISSLSNNYNYS 92 Query: 138 NRSVNS 121 N + N+ Sbjct: 93 NYNNNN 98 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.51 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = -3 Query: 318 RKGY*R*IFRDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK 139 RK Y R R+R Q +NE+S R K+ R+++E ++S+E + + S+ Y Sbjct: 36 RKRYSR--SREREQKSYKNENSYRKYRKTSKERSRDRTE-RERSKEPKIISSLSNNYNYS 92 Query: 138 NRSVNS 121 N + N+ Sbjct: 93 NYNNNN 98 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.51 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = -3 Query: 318 RKGY*R*IFRDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK 139 RK Y R R+R Q +NE+S R K+ R+++E ++S+E + + S+ Y Sbjct: 36 RKRYSR--SREREQKSYKNENSYRKYRKTSKERSRDRTE-RERSKEPKIISSLSNNYNYS 92 Query: 138 NRSVNS 121 N + N+ Sbjct: 93 NYNNNN 98 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.0 bits (52), Expect = 0.51 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = -3 Query: 318 RKGY*R*IFRDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK 139 RK Y R R+R Q +NE+S R K+ R+++E ++S+E + + S+ Y Sbjct: 36 RKRYSR--SREREQKSYKNENSYRKYRKTSKERSRDRTE-RERSKEPKIISSLSNNYNYS 92 Query: 138 NRSVNS 121 N + N+ Sbjct: 93 NYNNNN 98 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.6 bits (51), Expect = 0.67 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREK--SESNKKSREFENKEAESSTYRDKNRSVNSG 118 RDRN+ E K+D + E+EK E + R ++E E ++Y KN Sbjct: 228 RDRNR-----EYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQNSY--KNEREYRK 280 Query: 117 SERKSSGKDEEYSEQNSSNKS 55 S G+ + +E+ S ++ Sbjct: 281 YRETSKGRSRDRTERERSKET 301 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.6 bits (51), Expect = 0.67 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREK--SESNKKSREFENKEAESSTYRDKNRSVNSG 118 RDRN+ E K+D + E+EK E + R ++E E ++Y KN Sbjct: 239 RDRNR-----EYRKKDRQYEKLHNEKEKLLEERTSRKRYSRSREREQNSY--KNEREYRK 291 Query: 117 SERKSSGKDEEYSEQNSSNKS 55 S G+ + +E+ S ++ Sbjct: 292 YRETSKGRSRDRTERERSKET 312 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 0.88 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -3 Query: 219 EREKSESNKKSREF-ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 ERE+ +S K RE+ E +E RD+ S + S Y N +N + N+ Sbjct: 44 EREQ-KSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNNN 101 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 0.88 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -3 Query: 219 EREKSESNKKSREF-ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 ERE+ +S K RE+ E +E RD+ S + S Y N +N + N+ Sbjct: 44 EREQ-KSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNNN 101 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 0.88 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -3 Query: 219 EREKSESNKKSREF-ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 ERE+ +S K RE+ E +E RD+ S + S Y N +N + N+ Sbjct: 44 EREQ-KSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNNN 101 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 0.88 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -3 Query: 219 EREKSESNKKSREF-ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 ERE+ +S K RE+ E +E RD+ S + S Y N +N + N+ Sbjct: 44 EREQ-KSYKNEREYREYRETSRERSRDRKERERSKEPKIISSLSNNYKYSNYNNYNNNN 101 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.88 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFND 46 S + S Y+ N +N + N+ Sbjct: 75 RSKEPKIVSSLSNNYNYSNYNNYNNNN 101 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.2 bits (50), Expect = 0.88 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFND 46 S + S Y+ N +N + N+ Sbjct: 75 RSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.88 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFND 46 S + S Y+ N +N + N+ Sbjct: 75 RSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.88 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFND 46 S + S Y+ N +N + N+ Sbjct: 75 RSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.88 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFND 46 S + S Y+ N +N + N+ Sbjct: 75 RSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.88 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFND 46 S + S Y+ N +N + N+ Sbjct: 75 RSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.88 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFND 46 S + S Y+ N +N + N+ Sbjct: 75 RSKEPKIISSLSNNYNYSNYNNYNNNN 101 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 0.88 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 5/87 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRRERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFND 46 S + S Y+ N +N + N+ Sbjct: 75 RSKEPKIISSLSNNYNYSNYNNYNNNN 101 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.88 Identities = 15/69 (21%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFE-NKEAESSTYRDKNRSVNSGSERKSSG 97 I ++E+ + K ++ +S S R + E S + D+N N G S Sbjct: 197 IEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDSRHEDRNSYRNDGERSCSRD 256 Query: 96 KDEEYSEQN 70 + EY +++ Sbjct: 257 RSREYKKKD 265 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.88 Identities = 15/69 (21%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFE-NKEAESSTYRDKNRSVNSGSERKSSG 97 I ++E+ + K ++ +S S R + E S + D+N N G S Sbjct: 197 IEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDSRHEDRNSYRNDGERSCSRD 256 Query: 96 KDEEYSEQN 70 + EY +++ Sbjct: 257 RSREYKKKD 265 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.88 Identities = 15/69 (21%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFE-NKEAESSTYRDKNRSVNSGSERKSSG 97 I ++E+ + K ++ +S S R + E S + D+N N G S Sbjct: 197 IEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDSRHEDRNSYRNDGERSCSRD 256 Query: 96 KDEEYSEQN 70 + EY +++ Sbjct: 257 RSREYKKKD 265 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 24.2 bits (50), Expect = 0.88 Identities = 16/76 (21%), Positives = 30/76 (39%), Gaps = 1/76 (1%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFE-NKEAESSTYRDKNRSVNSGSERKSSG 97 I ++E+ + K ++ +S S R + E S + D+N N G S Sbjct: 197 IEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDSRHEDRNSYRNDGERSCSRD 256 Query: 96 KDEEYSEQNSSNKSFN 49 + EY + ++ N Sbjct: 257 RSREYKKDRRYDQLHN 272 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 0.88 Identities = 15/69 (21%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFE-NKEAESSTYRDKNRSVNSGSERKSSG 97 I ++E+ + K ++ +S S R + E S + D+N N G S Sbjct: 197 IEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDSRHEDRNSYRNDGERSCSRD 256 Query: 96 KDEEYSEQN 70 + EY +++ Sbjct: 257 RSREYKKKD 265 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 1.5 Identities = 19/83 (22%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRKERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNK 58 S + S Y+ N++ K Sbjct: 75 KSKEHKIISSLSNNYNYNNNNYK 97 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 1.5 Identities = 19/83 (22%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRKERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNK 58 S + S Y+ N++ K Sbjct: 75 KSKEHKIISSLSNNYNYNNNNYK 97 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 1.5 Identities = 19/83 (22%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESN-KKSREFEN-KEAESSTYRDKNRSV 127 +DR + NE K S+ + RE+ +++ K RE+ +E RD+ Sbjct: 15 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRETSKERSRDRKERE 74 Query: 126 NSGSERKSSGKDEEYSEQNSSNK 58 S + S Y+ N++ K Sbjct: 75 KSKEHKIISSLSNNYNYNNNNYK 97 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.4 bits (48), Expect = 1.5 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 189 SREFENKEAESSTYRDKNRSVNSGSERKSSG--KDEEYSEQNSSNKSFNDGD 40 S+ + + S +N+ RK+S ++E S +N+ NKS D D Sbjct: 145 SKSNGSNSSNSDVLFKQNKEEEQTINRKNSDYLDNQEVSMENTENKSCTDSD 196 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.0 bits (47), Expect = 2.0 Identities = 19/68 (27%), Positives = 35/68 (51%) Frame = -3 Query: 318 RKGY*R*IFRDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK 139 RK Y R R+R Q +NE+S R ++ R+K+E ++S+E + + S+ Y Sbjct: 274 RKRYSR--SREREQKSYKNENSYRKYRETSKERSRDKTE-RERSKERKIISSLSNNYISN 330 Query: 138 NRSVNSGS 115 + N+ + Sbjct: 331 ISNYNNNN 338 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 2.7 Identities = 15/69 (21%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFE-NKEAESSTYRDKNRSVNSGSERKSSG 97 I ++E+ + K ++ S S R + E S + D+N N G S Sbjct: 197 IEKSENETKTCKKYAISSNSLGSRSRSFQRTSSCHSRYEDSRHEDRNSYRNDGERSCSRD 256 Query: 96 KDEEYSEQN 70 + EY +++ Sbjct: 257 RSREYKKKD 265 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 2.7 Identities = 15/69 (21%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFE-NKEAESSTYRDKNRSVNSGSERKSSG 97 I ++E+ + K ++ +S S R + E S + D N N G S Sbjct: 197 IEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDSRHEDGNSYRNDGERSCSRD 256 Query: 96 KDEEYSEQN 70 + EY +++ Sbjct: 257 RSREYKKKD 265 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.6 bits (46), Expect = 2.7 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 5/101 (4%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESS--TYRDKNRSV 127 +DR + NE K S+ + RE+ + + K+ K E+S RD+ Sbjct: 248 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDR---- 303 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 4 +ER+ S K+ + S+N ++N+ + +Y +KK+ Sbjct: 304 ---TERERS-KERKIISSLSNNYNYNNNNYKYNYNNYNKKL 340 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 4.7 Identities = 13/56 (23%), Positives = 22/56 (39%) Frame = -3 Query: 213 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 E S K R F + + + ++ NSG+ +S DE Y + N + Sbjct: 22 EGGRSYGKGRGFIIQNNNNDDWSVGKKNSNSGTINESEFNDENYWQCNDKKTDIEE 77 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 308 TDDKYSETGTNKSSETKTASVMARRAASQS 219 TD+ E GTNK+ + + S +R S+S Sbjct: 233 TDNSRLEPGTNKNGKFFSRSSTSRIVISES 262 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 84 YSEQNSSNKSFNDGDASAD 28 Y E +SSN S+N S D Sbjct: 1046 YRETSSSNPSYNFSSVSGD 1064 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 84 YSEQNSSNKSFNDGDASAD 28 Y E +SSN S+N S D Sbjct: 1042 YRETSSSNPSYNFSSVSGD 1060 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 6.2 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 207 SESNKKSREFENKEAES--STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 S SN R EN + + + +DKN N + S K + E N + + ND Sbjct: 432 SSSNTWLRVNENYKTVNLAAEKKDKNSFFNMFKKFASLKKSPYFKEANLNTRMLND 487 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 6.2 Identities = 21/97 (21%), Positives = 37/97 (38%), Gaps = 5/97 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSK---RDGSKSGVTVEREKSESNKKSREFENKEAESS--TYRDKNRSV 127 +DR + NE K S+ + RE+ + + K+ K E+S RD+ Sbjct: 248 KDRRYEKLHNEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYRETSKERSRDRKERE 307 Query: 126 NSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTK 16 S + S Y N +N + + + +Y K Sbjct: 308 RSKEPKIISSLSNNYKYSNYNNYNNYNNNNYNNYNKK 344 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 6.2 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 207 SESNKKSREFENKEAES--STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 S SN R EN + + + +DKN N + S K + E N + + ND Sbjct: 432 SSSNTWLRVNENYKTVNLAAEKKDKNSFFNMFKKFASLKKSPYFKEANLNTRMLND 487 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,379 Number of Sequences: 438 Number of extensions: 2156 Number of successful extensions: 58 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -