BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0519.Seq (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28770.1 68416.m03591 expressed protein 42 2e-04 At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa... 42 4e-04 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 39 0.003 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 38 0.003 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 38 0.004 At2g22795.1 68415.m02704 expressed protein 38 0.006 At1g29470.1 68414.m03605 dehydration-responsive protein-related ... 37 0.008 At5g60530.1 68418.m07590 late embryogenesis abundant protein-rel... 36 0.018 At3g29075.1 68416.m03637 glycine-rich protein 36 0.018 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 36 0.024 At5g53800.1 68418.m06685 expressed protein 35 0.041 At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp... 35 0.041 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 35 0.041 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 35 0.041 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 35 0.041 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 34 0.072 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 34 0.072 At5g16680.1 68418.m01951 PHD finger family protein contains Pfam... 33 0.095 At1g56660.1 68414.m06516 expressed protein 33 0.095 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 33 0.13 At3g59800.1 68416.m06673 expressed protein 33 0.13 At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr... 33 0.13 At5g63550.1 68418.m07976 expressed protein 33 0.17 At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative simila... 33 0.17 At2g27470.1 68415.m03320 CCAAT-box binding transcription factor ... 33 0.17 At5g61150.2 68418.m07672 leo1-like family protein weak similarit... 32 0.22 At5g61150.1 68418.m07671 leo1-like family protein weak similarit... 32 0.22 At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim... 32 0.22 At4g15030.1 68417.m02309 expressed protein 32 0.22 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 32 0.22 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 32 0.22 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 32 0.29 At4g08350.1 68417.m01380 KOW domain-containing transcription fac... 32 0.29 At5g64030.1 68418.m08039 dehydration-responsive protein-related ... 31 0.38 At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein ... 31 0.38 At5g53440.1 68418.m06641 expressed protein 31 0.51 At4g33740.2 68417.m04791 expressed protein 31 0.51 At4g33740.1 68417.m04790 expressed protein 31 0.51 At3g48120.1 68416.m05248 expressed protein 31 0.51 At1g03530.1 68414.m00334 expressed protein similar to hypothetic... 31 0.51 At5g56360.1 68418.m07034 calmodulin-binding protein similar to a... 31 0.67 At5g16500.1 68418.m01928 protein kinase family protein contains ... 31 0.67 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 31 0.67 At3g05060.1 68416.m00549 SAR DNA-binding protein, putative stron... 31 0.67 At1g76820.1 68414.m08939 expressed protein 31 0.67 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 30 0.89 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 30 0.89 At5g47690.1 68418.m05887 expressed protein 30 1.2 At4g35940.1 68417.m05113 expressed protein 30 1.2 At3g25840.1 68416.m03219 protein kinase family protein contains ... 30 1.2 At2g34300.1 68415.m04196 dehydration-responsive protein-related ... 30 1.2 At5g62750.1 68418.m07877 expressed protein predicted proteins, C... 29 1.5 At4g00990.1 68417.m00133 transcription factor jumonji (jmjC) dom... 29 1.5 At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein ... 29 1.5 At1g03320.1 68414.m00311 hypothetical protein 29 1.5 At1g01440.1 68414.m00059 extra-large G-protein-related weak simi... 29 1.5 At5g58880.1 68418.m07377 hypothetical protein 29 2.0 At5g12230.1 68418.m01435 expressed protein 29 2.0 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 2.0 At2g12875.1 68415.m01402 hypothetical protein 29 2.0 At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calr... 29 2.0 At1g56110.1 68414.m06443 nucleolar protein Nop56, putative simil... 29 2.0 At1g07980.1 68414.m00869 histone-like transcription factor (CBF/... 29 2.0 At5g50840.2 68418.m06299 expressed protein 29 2.7 At5g50840.1 68418.m06298 expressed protein 29 2.7 At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-co... 29 2.7 At1g78580.1 68414.m09158 alpha, alpha-trehalose-phosphate syntha... 29 2.7 At1g75310.1 68414.m08748 DNAJ heat shock N-terminal domain-conta... 29 2.7 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 29 2.7 At1g51745.1 68414.m05831 expressed protein 29 2.7 At1g21630.1 68414.m02708 calcium-binding EF hand family protein ... 29 2.7 At5g65490.1 68418.m08236 expressed protein similar to unknown pr... 28 3.6 At5g61330.1 68418.m07696 rRNA processing protein-related contain... 28 3.6 At5g60030.1 68418.m07527 expressed protein 28 3.6 At4g25880.2 68417.m03722 pumilio/Puf RNA-binding domain-containi... 28 3.6 At4g25880.1 68417.m03721 pumilio/Puf RNA-binding domain-containi... 28 3.6 At4g02110.1 68417.m00282 BRCT domain-containing protein contains... 28 3.6 At3g58050.1 68416.m06471 expressed protein 28 3.6 At2g32250.2 68415.m03942 far-red impaired responsive protein, pu... 28 3.6 At2g32250.1 68415.m03941 far-red impaired responsive protein, pu... 28 3.6 At2g24440.1 68415.m02921 expressed protein 28 3.6 At1g70505.1 68414.m08114 expressed protein 28 3.6 At1g32150.1 68414.m03955 bZIP transcription factor family protei... 28 3.6 At1g21390.1 68414.m02676 expressed protein 28 3.6 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 28 3.6 At5g44690.1 68418.m05476 hypothetical protein 28 4.7 At3g07120.1 68416.m00848 zinc finger (C3HC4-type RING finger) fa... 28 4.7 At1g74830.1 68414.m08670 expressed protein contains Pfam profile... 28 4.7 At1g19880.1 68414.m02493 regulator of chromosome condensation (R... 28 4.7 At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative... 27 6.2 At4g18830.1 68417.m02779 ovate family protein 52% similar to ova... 27 6.2 At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)... 27 6.2 At4g12610.1 68417.m01987 transcription initiation factor IIF alp... 27 6.2 At3g50550.1 68416.m05528 expressed protein isoform contains a n... 27 6.2 At3g18810.1 68416.m02389 protein kinase family protein contains ... 27 6.2 At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing prote... 27 6.2 At2g38550.1 68415.m04736 expressed protein contains Pfam profile... 27 6.2 At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50... 27 6.2 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 27 6.2 At1g69070.1 68414.m07903 expressed protein 27 6.2 At1g35660.1 68414.m04432 expressed protein 27 6.2 At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) fa... 27 6.2 At5g66950.1 68418.m08440 expressed protein 27 8.3 At5g59730.1 68418.m07487 exocyst subunit EXO70 family protein le... 27 8.3 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 27 8.3 At5g37010.1 68418.m04438 expressed protein 27 8.3 At5g22450.1 68418.m02618 expressed protein 27 8.3 At4g37210.2 68417.m05267 tetratricopeptide repeat (TPR)-containi... 27 8.3 At4g37210.1 68417.m05268 tetratricopeptide repeat (TPR)-containi... 27 8.3 At4g26630.1 68417.m03837 expressed protein 27 8.3 At3g60110.1 68416.m06712 DNA-binding bromodomain-containing prot... 27 8.3 At3g11590.1 68416.m01416 expressed protein 27 8.3 At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family pr... 27 8.3 At2g44200.1 68415.m05500 expressed protein 27 8.3 At2g35210.1 68415.m04319 human Rev interacting-like family prote... 27 8.3 At1g76770.1 68414.m08934 heat shock protein-related contains sim... 27 8.3 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 27 8.3 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 27 8.3 At1g63420.1 68414.m07172 expressed protein 27 8.3 At1g27650.1 68414.m03379 U2 snRNP auxiliary factor small subunit... 27 8.3 At1g22882.1 68414.m02857 expressed protein 27 8.3 At1g15940.1 68414.m01913 expressed protein similar To androgen-i... 27 8.3 At1g05490.1 68414.m00559 C protein immunoglobulin-A-binding beta... 27 8.3 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 42.3 bits (95), Expect = 2e-04 Identities = 28/90 (31%), Positives = 40/90 (44%), Gaps = 2/90 (2%) Frame = -3 Query: 264 NEDSK-RDGSKSGVTVEREKSE-SNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 91 N+D+K + S+ + REK E KKS+ E + E +DK R ERKS + Sbjct: 993 NKDNKEKKESEDSASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKEK 1052 Query: 90 EEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 EE + + K + KSKK E Sbjct: 1053 EESRDLKAKKKEEETKEKKESENHKSKKKE 1082 Score = 41.5 bits (93), Expect = 4e-04 Identities = 28/94 (29%), Positives = 48/94 (51%) Frame = -3 Query: 282 NQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 103 N + + ED+K++ +KS + +E+++ NK E KE+E S KNR E+KS Sbjct: 968 NNELKKQEDNKKETTKSENSKLKEENKDNK-----EKKESEDSA--SKNREKKEYEEKKS 1020 Query: 102 SGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 K+E E+ S + S + ++K +K E Sbjct: 1021 KTKEEAKKEKKKSQDKKREEKDSEERKSKKEKEE 1054 Score = 36.3 bits (80), Expect = 0.013 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 2/91 (2%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRD-KNRSVNSGSERKSSGKD 91 + E +K + SK + E + ++ K+S + +K E Y + K+++ + K +D Sbjct: 978 KKETTKSENSK--LKEENKDNKEKKESEDSASKNREKKEYEEKKSKTKEEAKKEKKKSQD 1035 Query: 90 EEYSEQNS-SNKSFNDGDASADYQTKSKKVE 1 ++ E++S KS + + S D + K K+ E Sbjct: 1036 KKREEKDSEERKSKKEKEESRDLKAKKKEEE 1066 Score = 35.9 bits (79), Expect = 0.018 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE-RKSSGKDEE 85 EDSK V V+ K ES KK RE + +SST ++ + N + +K SG+ + Sbjct: 856 EDSKDLKDDRSVEVKANKEESMKKKREEVQRNDKSSTKEVRDFANNMDIDVQKGSGESVK 915 Query: 84 Y--SEQNSSNKSFNDGDASADYQTKSK 10 Y E+ NK N + + K K Sbjct: 916 YKKDEKKEGNKEENKDTINTSSKQKGK 942 Score = 32.7 bits (71), Expect = 0.17 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 7/101 (6%) Frame = -3 Query: 282 NQ*IIRNEDSKRDGSKS-GVTVEREKSESNKKSREFE---NKEAESSTYRD--KNRSVNS 121 N+ +RN++ G+K VE+ + + +K ++ E NK+ S+ RD K RS Sbjct: 764 NENRVRNKEENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEAKERSGED 823 Query: 120 GSERKSSGKDEEYSEQNSSNKSFNDG-DASADYQTKSKKVE 1 E K KD Y + K+ N G D + + SK ++ Sbjct: 824 NKEDKEESKD--YQSVEAKEKNENGGVDTNVGNKEDSKDLK 862 Score = 31.9 bits (69), Expect = 0.29 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 8/90 (8%) Frame = -3 Query: 261 EDSKRDGSKSGVTVE----REKS--ESNKKSREFENKEAESSTYRD--KNRSVNSGSERK 106 EDS ++GS+ G TVE E S E +K + E KE + ++ ++ K+ + G E K Sbjct: 1647 EDSIKEGSEDGKTVEINGGEELSTEEGSKDGKIEEGKEGKENSTKEGSKDDKIEEGMEGK 1706 Query: 105 SSGKDEEYSEQNSSNKSFNDGDASADYQTK 16 + +E S+ N+ D +A+ + +K Sbjct: 1707 EN-STKESSKDGKINEIHGDKEATMEEGSK 1735 Score = 29.9 bits (64), Expect = 1.2 Identities = 24/76 (31%), Positives = 33/76 (43%), Gaps = 4/76 (5%) Frame = -3 Query: 261 EDSKRDG--SKSGVTVE-REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 91 ED+K D SK +VE +EK+E+ NKE D++ V + E K Sbjct: 822 EDNKEDKEESKDYQSVEAKEKNENGGVDTNVGNKEDSKDLKDDRSVEVKANKEESMKKKR 881 Query: 90 EEYSEQN-SSNKSFND 46 EE + SS K D Sbjct: 882 EEVQRNDKSSTKEVRD 897 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/91 (21%), Positives = 39/91 (42%), Gaps = 4/91 (4%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK----SSGK 94 E K DGS +E ++ + + ++ ENKE+++ + DK SV+ E K Sbjct: 684 EVKKNDGSSEKGEEGKENNKDSMEDKKLENKESQTDSKDDK--SVDDKQEEAQIYGGESK 741 Query: 93 DEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 D++ E K + + + + + E Sbjct: 742 DDKSVEAKGKKKESKENKKTKTNENRVRNKE 772 >At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 3 WD-40 repeats (PF00400);similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56 (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens] Length = 1305 Score = 41.5 bits (93), Expect = 4e-04 Identities = 26/86 (30%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Frame = -3 Query: 252 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK----SSGKDEE 85 K DG + + ++ +SN KS + + ++ S + + + NS S++K SS K + Sbjct: 1175 KSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGDTNSKSQKKGDGDSSSKSHK 1234 Query: 84 YSEQNSSNKSF--NDGDASADYQTKS 13 ++ +SS+KS NDGD+S+ KS Sbjct: 1235 KNDGDSSSKSHKKNDGDSSSKSHKKS 1260 Score = 40.3 bits (90), Expect = 8e-04 Identities = 21/81 (25%), Positives = 37/81 (45%) Frame = -3 Query: 252 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQ 73 K DG + + ++ +SN KS + + ++ S + + + NS S +KS G S + Sbjct: 1139 KSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSK 1198 Query: 72 NSSNKSFNDGDASADYQTKSK 10 S S + +D T SK Sbjct: 1199 KSDGDSCSKSQKKSDGDTNSK 1219 Score = 39.5 bits (88), Expect = 0.001 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 6/86 (6%) Frame = -3 Query: 252 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG----KDEE 85 K DG + + ++ +SN KS + + ++ S + + + NS S +KS G K + Sbjct: 1127 KSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSK 1186 Query: 84 YSEQNSSNKSF--NDGDASADYQTKS 13 S+ +S++KS +DGD+ + Q KS Sbjct: 1187 KSDGDSNSKSSKKSDGDSCSKSQKKS 1212 Score = 38.3 bits (85), Expect = 0.003 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 4/85 (4%) Frame = -3 Query: 252 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG----KDEE 85 K DG + + ++ +SN KS + + ++ S + + + NS S +KS G K ++ Sbjct: 1151 KSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQK 1210 Query: 84 YSEQNSSNKSFNDGDASADYQTKSK 10 S+ ++++KS GD + ++ K Sbjct: 1211 KSDGDTNSKSQKKGDGDSSSKSHKK 1235 Score = 38.3 bits (85), Expect = 0.003 Identities = 24/86 (27%), Positives = 46/86 (53%), Gaps = 6/86 (6%) Frame = -3 Query: 252 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG----KDEE 85 K DG + + ++ +SN KS + + ++ S + + + S S++KS G K ++ Sbjct: 1163 KSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGDTNSKSQK 1222 Query: 84 YSEQNSSNKSF--NDGDASADYQTKS 13 + +SS+KS NDGD+S+ K+ Sbjct: 1223 KGDGDSSSKSHKKNDGDSSSKSHKKN 1248 Score = 35.5 bits (78), Expect = 0.024 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 5/87 (5%) Frame = -3 Query: 258 DSKRDGSKSGVTVERE---KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 DS SKS + E S+S+KKS N ++ + D N + S+ S+ K Sbjct: 1102 DSNPSNSKSQSLKKNEGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSS 1161 Query: 87 EYSEQNSSNKSF--NDGDASADYQTKS 13 + S+ +S++KS +DGD+++ KS Sbjct: 1162 KKSDGDSNSKSSKKSDGDSNSKSSKKS 1188 Score = 34.7 bits (76), Expect = 0.041 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 3/94 (3%) Frame = -3 Query: 285 RNQ*IIRNE-DSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSER 109 ++Q + +NE DS SK + S+S+KKS N ++ + D N + S+ Sbjct: 1109 KSQSLKKNEGDSNSKSSKK--SDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDG 1166 Query: 108 KSSGKDEEYSEQNSSNKSF--NDGDASADYQTKS 13 S+ K + S+ +S++KS +DGD+++ KS Sbjct: 1167 DSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKS 1200 Score = 33.9 bits (74), Expect = 0.072 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 2/93 (2%) Frame = -3 Query: 288 DRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSER 109 D N + D + S + S+S+KKS N ++ + D N + S+ Sbjct: 1131 DSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDG 1190 Query: 108 KSSGKDEEYSEQNSSNKS--FNDGDASADYQTK 16 S+ K + S+ +S +KS +DGD ++ Q K Sbjct: 1191 DSNSKSSKKSDGDSCSKSQKKSDGDTNSKSQKK 1223 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 38.7 bits (86), Expect = 0.003 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 7/101 (6%) Frame = -3 Query: 288 DRNQ*IIRNEDSKRDGSKSGVTV-EREKSESNKKSREFENKEAESSTYRDKNRS-VNSGS 115 D + I R D +R+ KS V E++K + + ++ EN E ++ +DK+R+ V + Sbjct: 73 DTEKEISRGRDKEREKDKSRDRVKEKDKEKERNRHKDREN-ERDNEKEKDKDRARVKERA 131 Query: 114 ERKSSGKDEEYSE-----QNSSNKSFNDGDASADYQTKSKK 7 +KS D+E + ++S N+ N+G + D + K+ Sbjct: 132 SKKSHEDDDETHKAAERYEHSDNRGLNEGGDNVDAASSGKE 172 Score = 35.1 bits (77), Expect = 0.031 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSRE-FENKEAESSTYRDKNRSVNSGS 115 RDR + R+ED++++ S+ R+K KSR+ + K+ E R K+R N Sbjct: 64 RDRKR--SRDEDTEKEISRG-----RDKEREKDKSRDRVKEKDKEKERNRHKDRE-NERD 115 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGD 40 K KD ++ +S KS D D Sbjct: 116 NEKEKDKDRARVKERASKKSHEDDD 140 Score = 33.1 bits (72), Expect = 0.13 Identities = 30/101 (29%), Positives = 48/101 (47%), Gaps = 6/101 (5%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 112 +D ++ IR++D +RD +EK K+SR+ E+ E E S RDK R + + Sbjct: 44 KDYDREKIRDKDHRRD---------KEKERDRKRSRD-EDTEKEISRGRDKEREKDKSRD 93 Query: 111 R-KSSGKDEEYS-----EQNSSNKSFNDGDASADYQTKSKK 7 R K K++E + E N+ D D + + SKK Sbjct: 94 RVKEKDKEKERNRHKDRENERDNEKEKDKDRARVKERASKK 134 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/72 (23%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK-SSGK 94 +R R K + ++EK +K R+ +++ + RD+ RS + +E++ S G+ Sbjct: 24 VREHRDGRRKEKDHRSKDKEKDYDREKIRDKDHRR-DKEKERDRKRSRDEDTEKEISRGR 82 Query: 93 DEEYSEQNSSNK 58 D+E + S ++ Sbjct: 83 DKEREKDKSRDR 94 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 38.3 bits (85), Expect = 0.003 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 5/92 (5%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 82 ED +RD + ++ ++SRE N+E++ RD R G ERK +++ Sbjct: 178 EDGERDRREREKERGSRRNRERERSREVGNEESDDDVKRDLKRRRKEGGERKEKEREKSV 237 Query: 81 S-----EQNSSNKSFNDGDASADYQTKSKKVE 1 E + KS D + +T+ +++E Sbjct: 238 GRSSRHEDSPKRKSVEDNGEKKEKKTREEELE 269 Score = 31.5 bits (68), Expect = 0.38 Identities = 26/96 (27%), Positives = 43/96 (44%), Gaps = 1/96 (1%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNK-KSREFENKEAESSTYRDKNRSVNSGS 115 RDR + +D +R+ K ERE+ E K + +E E +E E + R GS Sbjct: 136 RDRER--EERKDKEREREKDRERREREREEREKERVKERERREREDGERDRREREKERGS 193 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKK 7 R ++ E S + + +S D D D + + K+ Sbjct: 194 RR---NRERERSREVGNEES--DDDVKRDLKRRRKE 224 Score = 30.7 bits (66), Expect = 0.67 Identities = 17/70 (24%), Positives = 35/70 (50%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 R +D ++ KS + + + +++ + + KE E RDK+R RKSS ++ Sbjct: 45 REKDRRKKRVKSSDSEDDYDRDDDEEREKRKEKERERRR-RDKDRVKRRSERRKSSDSED 103 Query: 87 EYSEQNSSNK 58 + E++ +K Sbjct: 104 DVEEEDERDK 113 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Frame = -3 Query: 222 VEREKSESNKKSREFENKEAE-SSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 +E EKS+ + + +EA+ + RD++R +ERK E+ E++ K Sbjct: 1 MEVEKSKYRSEDLDVVEEEADLKKSRRDRDR----SNERKKDKGSEKRREKDRRKKRVKS 56 Query: 45 GDASADY 25 D+ DY Sbjct: 57 SDSEDDY 63 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = -3 Query: 219 EREKSESNKKSREFE--NKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 58 +R+KSES K+ E E KEA ST +++ R S S+++S G++E E + S K Sbjct: 733 KRKKSESKKEGGEGEETQKEANESTKKERKRK-KSESKKQSDGEEETQKEPSESTK 787 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 37.5 bits (83), Expect = 0.006 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 8/102 (7%) Frame = -3 Query: 282 NQ*IIRNEDSKRDGSKSGVTV--EREKSESNKKSREFEN---KEAESSTYRDKNRSVNSG 118 N+ I + E S ++ SK T E+E+S S ++++E EN ++ ES+ + N Sbjct: 544 NEKIEKEEASSQEESKENETETKEKEESSSQEETKEKENEKIEKEESAPQEETKEKENEK 603 Query: 117 SERKSSGKDEEYSEQNSSNK---SFNDGDASADYQTKSKKVE 1 E++ S EE E+ + K + ++ + T+S+K E Sbjct: 604 IEKEESASQEETKEKETETKEKEESSSNESQENVNTESEKKE 645 Score = 34.7 bits (76), Expect = 0.041 Identities = 18/86 (20%), Positives = 43/86 (50%), Gaps = 2/86 (2%) Frame = -3 Query: 258 DSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK--NRSVNSGSERKSSGKDEE 85 + K+D + + E+ +E ++ + +N +E S +K NR ++ E K DE+ Sbjct: 232 EEKKDNGGTEESREKSGTEESEVEEKKDNGSSEESEVEEKKENRGIDESEESKEKDIDEK 291 Query: 84 YSEQNSSNKSFNDGDASADYQTKSKK 7 + + + ++ DAS++ +S++ Sbjct: 292 ANIEEARENNYKGDDASSEVVHESEE 317 Score = 34.3 bits (75), Expect = 0.054 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 5/92 (5%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESN----KKSREFENKE-AESSTYRDKNRSVNSGSERKSSG 97 E S ++ +K + EK E++ K E E KE ESS+ + N E++ S Sbjct: 532 ESSSQEETKDKENEKIEKEEASSQEESKENETETKEKEESSSQEETKEKENEKIEKEESA 591 Query: 96 KDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 EE E+ N+ ++++ +TK K+ E Sbjct: 592 PQEETKEK--ENEKIEKEESASQEETKEKETE 621 Score = 33.9 bits (74), Expect = 0.072 Identities = 18/80 (22%), Positives = 42/80 (52%), Gaps = 1/80 (1%) Frame = -3 Query: 237 KSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 58 K +E+E+S ++++E EN++ E ++++ S E+++ K++E S N S + Sbjct: 580 KENEKIEKEESAPQEETKEKENEKIE----KEESASQEETKEKETETKEKEESSSNESQE 635 Query: 57 SFN-DGDASADYQTKSKKVE 1 + N + + + KK + Sbjct: 636 NVNTESEKKEQVEENEKKTD 655 Score = 33.1 bits (72), Expect = 0.13 Identities = 21/86 (24%), Positives = 39/86 (45%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 NE ++ E S+ K +E E KE E S+ + +VN+ SE+K ++ E Sbjct: 601 NEKIEK---------EESASQEETKEKETETKEKEESSSNESQENVNTESEKKEQVEENE 651 Query: 84 YSEQNSSNKSFNDGDASADYQTKSKK 7 +++S + S Q +S++ Sbjct: 652 KKTDEDTSESSKENSVSDTEQKQSEE 677 Score = 32.7 bits (71), Expect = 0.17 Identities = 19/87 (21%), Positives = 37/87 (42%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 +NED + + +S E ++ E K +E E+ E + ++ N S + KD+ Sbjct: 484 KNEDKETEKIESSFLEETKEKEDETKEKE-ESSSQEKTEEKETETKDNEESSSQEETKDK 542 Query: 87 EYSEQNSSNKSFNDGDASADYQTKSKK 7 E + S + + +TK K+ Sbjct: 543 ENEKIEKEEASSQEESKENETETKEKE 569 Score = 32.3 bits (70), Expect = 0.22 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-SERKSSGKDEE 85 E + ++G T E EKS S + E + + R+K+ + S E+K +G EE Sbjct: 206 ESEVEERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTEESEVEEKKDNGSSEE 265 Query: 84 YS-EQNSSNKSFNDGDASADYQTKSK 10 E+ N+ ++ + S + K Sbjct: 266 SEVEEKKENRGIDESEESKEKDIDEK 291 Score = 30.7 bits (66), Expect = 0.67 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE--RKSSGK 94 ++ + KSG T E E E + EN+++ S + + N G+E R+ SG Sbjct: 191 KDNGGTEENEKSG-TEESEVEERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGT 249 Query: 93 DEEYSEQNSSNKSFNDGD 40 +E E+ N S + + Sbjct: 250 EESEVEEKKDNGSSEESE 267 Score = 30.3 bits (65), Expect = 0.89 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 5/90 (5%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-SERKSSGKDEE 85 E + +G T E EKS + + E E KE + +K+ S S E+K +G EE Sbjct: 184 ESEVEERKDNGGTEENEKSGTEESEVE-ERKENGGTEENEKSGSEESEVEEKKDNGGTEE 242 Query: 84 YSEQNSSNKS----FNDGDASADYQTKSKK 7 E++ + +S D +S + + + KK Sbjct: 243 SREKSGTEESEVEEKKDNGSSEESEVEEKK 272 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/84 (23%), Positives = 35/84 (41%), Gaps = 1/84 (1%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS-ERKSSGKDE 88 N + KSG T E E E EN+++ + + R N G+ E + SG +E Sbjct: 148 NGGGTEENEKSG-TEESEVEERKDNGGTEENEKSGTEESEVEERKDNGGTEENEKSGTEE 206 Query: 87 EYSEQNSSNKSFNDGDASADYQTK 16 E+ N + + S +++ Sbjct: 207 SEVEERKENGGTEENEKSGSEESE 230 Score = 27.9 bits (59), Expect = 4.7 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS-ERKSSGKD 91 ++ + KSG T E E E EN+++ + + R N G+ E + SG + Sbjct: 169 KDNGGTEENEKSG-TEESEVEERKDNGGTEENEKSGTEESEVEERKENGGTEENEKSGSE 227 Query: 90 EEYSEQNSSN 61 E E+ N Sbjct: 228 ESEVEEKKDN 237 >At1g29470.1 68414.m03605 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 37.1 bits (82), Expect = 0.008 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 4/93 (4%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYR-DKNRSVNSGSE---RK 106 + + K D KSG EK+ES ++ +EF++K + D + S S+ +K Sbjct: 89 VTETNEEKTDPEKSGEENSGEKTESAEERKEFDDKNGDGDRKNGDGEKDTESESDETKQK 148 Query: 105 SSGKDEEYSEQNSSNKSFNDGDASADYQTKSKK 7 + EE SE+N S S + + + + ++K Sbjct: 149 EKTQLEESSEENKSEDSNGTEENAGESEENTEK 181 Score = 33.9 bits (74), Expect = 0.072 Identities = 20/86 (23%), Positives = 44/86 (51%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 82 +D DG + E++ + ++++ E + E S+ ++N+S +S +++G+ Sbjct: 121 DDKNGDGDRKNGDGEKDTESESDETKQKEKTQLEESS--EENKSEDSNGTEENAGE---- 174 Query: 81 SEQNSSNKSFNDGDASADYQTKSKKV 4 SE+N+ KS + + + KSK V Sbjct: 175 SEENTEKKSEENAGETEESTEKSKDV 200 Score = 30.7 bits (66), Expect = 0.67 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 2/78 (2%) Frame = -3 Query: 267 RNEDSKRDG-SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 91 +N D ++D S+S T ++EK++ + S E NK +S+ + +E+KS Sbjct: 130 KNGDGEKDTESESDETKQKEKTQLEESSEE--NKSEDSNGTEENAGESEENTEKKSEENA 187 Query: 90 EEYSEQNSSNKS-FNDGD 40 E E +K F GD Sbjct: 188 GETEESTEKSKDVFPAGD 205 >At5g60530.1 68418.m07590 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 439 Score = 35.9 bits (79), Expect = 0.018 Identities = 21/83 (25%), Positives = 40/83 (48%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 82 E K+D K+ ++EK + +K+ +E ++KE + +DK ERK + E+ Sbjct: 62 EQEKKDKEKAAKD-KKEKEKKDKEEKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEK- 119 Query: 81 SEQNSSNKSFNDGDASADYQTKS 13 + K + +A+A Y+ S Sbjct: 120 ERKAKEKKDKEESEAAARYRILS 142 Score = 31.9 bits (69), Expect = 0.29 Identities = 19/88 (21%), Positives = 35/88 (39%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 91 ++ + K D KS ++K E KK +E K+ + +DK ERK K Sbjct: 41 VQVDKGKGDNGKSNGNGPKDK-EQEKKDKEKAAKDKKEKEKKDKEEKEKKDKERKEKEKK 99 Query: 90 EEYSEQNSSNKSFNDGDASADYQTKSKK 7 ++ ++ + + + K KK Sbjct: 100 DKLEKEKKDKERKEKERKEKERKAKEKK 127 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 35.9 bits (79), Expect = 0.018 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 4/79 (5%) Frame = -3 Query: 264 NEDSKRDGSK--SGVTVER--EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 97 +ED DG K SG + EKS+ +K ++ + K+ +++ D+ + + K Sbjct: 138 HEDDGDDGHKKHSGKDYDDGDEKSKKKEKEKKKDKKKDGNNSEDDEFKKKKKKEQYKEHH 197 Query: 96 KDEEYSEQNSSNKSFNDGD 40 D++Y E+ K +ND D Sbjct: 198 DDDDYDEKKKKKKDYNDDD 216 Score = 31.5 bits (68), Expect = 0.38 Identities = 14/78 (17%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFE--NKEAESSTYRDKNRSVNSGSERKSSGK 94 + ++ K+D K G E ++ + KK +++ + + + + K + N E+K Sbjct: 164 KEKEKKKDKKKDGNNSEDDEFKKKKKKEQYKEHHDDDDYDEKKKKKKDYNDDDEKKKKKH 223 Query: 93 DEEYSEQNSSNKSFNDGD 40 + ++ ++ND D Sbjct: 224 YNDDDDEKKKKHNYNDDD 241 Score = 30.7 bits (66), Expect = 0.67 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 4/73 (5%) Frame = -3 Query: 246 DGSKSGVTVEREKSESNKK----SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 79 DG + E+EK + KK S + E K+ + ++ + E+K KD Sbjct: 156 DGDEKSKKKEKEKKKDKKKDGNNSEDDEFKKKKKKEQYKEHHDDDDYDEKKKKKKDYNDD 215 Query: 78 EQNSSNKSFNDGD 40 ++ K +ND D Sbjct: 216 DEKKKKKHYNDDD 228 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 35.5 bits (78), Expect = 0.024 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 2/81 (2%) Frame = -3 Query: 264 NEDSKRDGSKSGVTV-EREKSESNKKSREFENKEAESSTYRDKNRSVN-SGSERKSSGKD 91 +E+ ++D K TV E E+ + K +EFE ++ + RD++ G++ + G+ Sbjct: 134 SEEKEKDNGKENQTVQESEEGQMKKVVKEFEKEQKQQ---RDEDAGTQPKGTQGQEQGQG 190 Query: 90 EEYSEQNSSNKSFNDGDASAD 28 +E + NK + D++ D Sbjct: 191 KEQPDVEQGNKQGQEQDSNTD 211 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 34.7 bits (76), Expect = 0.041 Identities = 24/86 (27%), Positives = 34/86 (39%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 R+ +RD S S E SES + + E E+E R K + E K + Sbjct: 95 RSRRRRRDYSSSSSDSE---SESESEYSDSEESESEDERRRRKRKRKEREEEEKERKRRR 151 Query: 87 EYSEQNSSNKSFNDGDASADYQTKSK 10 ++ NKS DGD + K K Sbjct: 152 REKDKKKRNKSDKDGDKKRKEKKKKK 177 >At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 930 Score = 34.7 bits (76), Expect = 0.041 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 6/76 (7%) Frame = -3 Query: 216 REKSESNKKSREFENKEAESSTYRDKNRSVNSG----SERKSSGKDEEYSEQNSSNKSFN 49 +EK E S ++E +S R+K+ SG S +SSG + N ++ N Sbjct: 801 KEKVEEKTSSLTLGSEEEKSRKKREKSPGKRSGGNDLSSSESSGDERRRKRYNKKDRHRN 860 Query: 48 D--GDASADYQTKSKK 7 D D+S+DY ++ K+ Sbjct: 861 DSESDSSSDYHSRDKQ 876 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 34.7 bits (76), Expect = 0.041 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVER--EKSESNKKSREFENKEAESSTYRDKNRSVNSG 118 +DR + R++D +RD S + +R EKS+ + ++ +++E + R ++ S G Sbjct: 52 KDREREKGRDKDRERDSEVSRRSRDRDGEKSKERSRDKDRDHRERHHRSSRHRDHSRERG 111 Query: 117 SERKSSGKDEE 85 R+ G+D++ Sbjct: 112 ERRERGGRDDD 122 Score = 29.1 bits (62), Expect = 2.0 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 115 RD + R++D +R+ G +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRERE---KGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGD 40 R S +D + D D Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD 122 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 34.7 bits (76), Expect = 0.041 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVER--EKSESNKKSREFENKEAESSTYRDKNRSVNSG 118 +DR + R++D +RD S + +R EKS+ + ++ +++E + R ++ S G Sbjct: 52 KDREREKGRDKDRERDSEVSRRSRDRDGEKSKERSRDKDRDHRERHHRSSRHRDHSRERG 111 Query: 117 SERKSSGKDEE 85 R+ G+D++ Sbjct: 112 ERRERGGRDDD 122 Score = 29.1 bits (62), Expect = 2.0 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 115 RD + R++D +R+ G +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRERE---KGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGD 40 R S +D + D D Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD 122 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 34.7 bits (76), Expect = 0.041 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVER--EKSESNKKSREFENKEAESSTYRDKNRSVNSG 118 +DR + R++D +RD S + +R EKS+ + ++ +++E + R ++ S G Sbjct: 52 KDREREKGRDKDRERDSEVSRRSRDRDGEKSKERSRDKDRDHRERHHRSSRHRDHSRERG 111 Query: 117 SERKSSGKDEE 85 R+ G+D++ Sbjct: 112 ERRERGGRDDD 122 Score = 29.1 bits (62), Expect = 2.0 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 1/85 (1%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 115 RD + R++D +R+ G +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRERE---KGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGD 40 R S +D + D D Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD 122 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 33.9 bits (74), Expect = 0.072 Identities = 20/84 (23%), Positives = 36/84 (42%) Frame = -3 Query: 252 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQ 73 ++ S++G R + E R+ E + + T R ++RSV ++ K +DEE Sbjct: 622 EKKSSRAGSRSPRRRKEVKSTPRDDEENKVKRRT-RSRSRSVEDSADIKDKSRDEELKHH 680 Query: 72 NSSNKSFNDGDASADYQTKSKKVE 1 ++S + D S T E Sbjct: 681 KKRSRSRSREDRSKTRDTSRNSDE 704 Score = 28.7 bits (61), Expect = 2.7 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 7/96 (7%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK------NRSVNSGSERK 106 R+++ S+ +V +K +S ++ E +SS+ +K +RS E K Sbjct: 581 RSDEHHSSSSRRSRSVSPKKRKSGQEDSELSRLRRDSSSRGEKKSSRAGSRSPRRRKEVK 640 Query: 105 SSGKDEEYSEQNSSNKSFNDG-DASADYQTKSKKVE 1 S+ +D+E ++ +S + + SAD + KS+ E Sbjct: 641 STPRDDEENKVKRRTRSRSRSVEDSADIKDKSRDEE 676 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 33.9 bits (74), Expect = 0.072 Identities = 20/86 (23%), Positives = 37/86 (43%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 R E+ + S +++ K E K + E E + + + S + E K S + E Sbjct: 1466 RGEEKGTAENVSSTKIQQTKDELEKPRKPSEISE-NHNIHEFMDSSQSQDIEEKGSDQAE 1524 Query: 87 EYSEQNSSNKSFNDGDASADYQTKSK 10 +Y++QN + ND D +Y + Sbjct: 1525 KYAKQNKIQEVMNDEDKKEEYHISER 1550 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/87 (21%), Positives = 37/87 (42%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 82 E+ DG K + V K+E+NK R E +E + DK + ++ G+ ++ Sbjct: 666 EEKVCDGGKGIIAVAETKAENNKSKRVQETEEQK----LDKEDTCGKHFQKLIEGEISDH 721 Query: 81 SEQNSSNKSFNDGDASADYQTKSKKVE 1 E K +A + ++++ E Sbjct: 722 GEVEDVEKGKKRTEAEKRIKDRAREAE 748 >At5g16680.1 68418.m01951 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1290 Score = 33.5 bits (73), Expect = 0.095 Identities = 23/79 (29%), Positives = 33/79 (41%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 91 ++ E + S V EK +KSR NKE + + RS E + GK Sbjct: 202 VKLESLQNPSSNHDDRVSSEKGNFKEKSRPGGNKERQEPSVEGSTRS----GENRKDGKS 257 Query: 90 EEYSEQNSSNKSFNDGDAS 34 + S NSS S ++ D S Sbjct: 258 SKSSSSNSSAVSESESDDS 276 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 33.5 bits (73), Expect = 0.095 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 3/89 (3%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKS--ESNKKSREFENKEAESSTYR-DKNRSVNSGSERKSSGK 94 +++ K SK E+++S E KK + E KE + ST + DK G K + Sbjct: 239 DQEMKEKDSKKNKKKEKDESCAEEKKKKPDKEKKEKDESTEKEDKKLKGKKGKGEKPEKE 298 Query: 93 DEEYSEQNSSNKSFNDGDASADYQTKSKK 7 DE + D +AD++ KK Sbjct: 299 DEGKKTKEHDATEQEMDDEAADHKEGKKK 327 Score = 29.5 bits (63), Expect = 1.5 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 6/76 (7%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKK----SREFENKEAESSTYRDKNRSVNSGSE-RKS 103 + + +K++ +SG + +K++ KK S+E E E E K SG+E +K Sbjct: 133 KKKKNKKEKDESGPEEKNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESGTEEKKK 192 Query: 102 SGKDE-EYSEQNSSNK 58 K E + E++ SN+ Sbjct: 193 KPKKEKKQKEESKSNE 208 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/90 (18%), Positives = 40/90 (44%), Gaps = 6/90 (6%) Frame = -3 Query: 258 DSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNR-SVNSGSERKSSGKDEEY 82 + +++G K E+++S +K+++ + ++ ++K G + K KDE Sbjct: 127 EEEKEGKKKKNKKEKDESGPEEKNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESG 186 Query: 81 SEQ-----NSSNKSFNDGDASADYQTKSKK 7 +E+ K + ++ D + K KK Sbjct: 187 TEEKKKKPKKEKKQKEESKSNEDKKVKGKK 216 Score = 28.3 bits (60), Expect = 3.6 Identities = 20/85 (23%), Positives = 33/85 (38%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 82 ED D K G V ++ E + + E KE++ + + G E+K +EE Sbjct: 75 EDKDDDKKKDGKMVSKKHEEGHG---DLEVKESDVKV-EEHEKEHKKGKEKKHEELEEEK 130 Query: 81 SEQNSSNKSFNDGDASADYQTKSKK 7 + NK D + K+ K Sbjct: 131 EGKKKKNKKEKDESGPEEKNKKADK 155 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/73 (21%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = -3 Query: 219 EREKSESNKKSREF--ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 E + +E KKS+ E++E + +DK ++ ++ +DEE + +S + Sbjct: 407 EEDDTEEKKKSKVEGGESEEGKKKKKKDKKKNKKKDTKEPKMTEDEEEKKDDSKDVKIEG 466 Query: 45 GDASADYQTKSKK 7 A + + K K Sbjct: 467 SKAKEEKKDKDVK 479 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/88 (22%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = -3 Query: 288 DRNQ*-IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 112 +RNQ II ++ + D +S R +++S R+ +E + RD++R + + Sbjct: 848 NRNQKSIIERKEKREDSQESSKKRHRGENKSQSPPRKSSTRERDHDLGRDRDRERHRDRD 907 Query: 111 RKSSGKDEEYSEQNSSNKSFNDGDASAD 28 R+ + + SS+ +D D S + Sbjct: 908 RQHDLNRDRDRREKSSSHDRDDNDRSKE 935 >At3g59800.1 68416.m06673 expressed protein Length = 186 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/72 (27%), Positives = 39/72 (54%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 94 ++R ++ D +S + + + ++ S+ KSR+ + K+ +S + K R S SE SS Sbjct: 79 LMREYRAQLDAERS-LKLSKGRNYSSDKSRK-DKKDRDSKKKKSKKRKHYSSSESSSSSD 136 Query: 93 DEEYSEQNSSNK 58 ++E SS+K Sbjct: 137 EDESRRSRSSSK 148 >At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 384 Score = 33.1 bits (72), Expect = 0.13 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVT--VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 97 + E K + K G T E EK + +K+ E ENKEAE + ++ V++ K +G Sbjct: 169 VNKEGEKTEAGKEGQTEIAEAEKEKEGEKA-EAENKEAEVVRDKKESMEVDTSELEKKAG 227 Query: 96 KDEEYSE 76 E E Sbjct: 228 SGEGAEE 234 Score = 31.5 bits (68), Expect = 0.38 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = -3 Query: 264 NEDSKRDGSKSGVT----VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 97 N +++++ K GVT E+E +E K E NKE E + + ++ + +E++ G Sbjct: 136 NAEAEKEKEKEGVTEIAEAEKENNEGEKTEAEKVNKEGEKTEAGKEGQTEIAEAEKEKEG 195 Query: 96 KDEEYSEQNSSNKSFNDGDASADYQT 19 E+ +N + D S + T Sbjct: 196 --EKAEAENKEAEVVRDKKESMEVDT 219 >At5g63550.1 68418.m07976 expressed protein Length = 530 Score = 32.7 bits (71), Expect = 0.17 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -1 Query: 338 DDSDKNRGKDTDDKYSETGTNKSSETKTASVMARRAASQSKGKNPNPT 195 ++SD + DTDD+ E K S+ K++S +S SKGK+ P+ Sbjct: 315 EESDHEK-TDTDDEKDEVEVEKPSKKKSSSKKTVEESSGSKGKDKQPS 361 >At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative similar to RNA helicase GB:A57514 GI:897915 from [Rattus norvegicus]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 989 Score = 32.7 bits (71), Expect = 0.17 Identities = 23/104 (22%), Positives = 40/104 (38%), Gaps = 5/104 (4%) Frame = -3 Query: 297 IFRDRNQ*IIRNEDSKRDGSKSGVTV-----EREKSESNKKSREFENKEAESSTYRDKNR 133 I RDR E+ +RD + G ER++ R+ E +E E R K + Sbjct: 48 IRRDRKSSDFEEEEYERDSKRRGEDKGRGRRERDRDRGKYLKRDRERREREKEKGRKKQK 107 Query: 132 SVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 S + D + + + GD + +T+ ++VE Sbjct: 108 KERSREDCNEESDDVKCGLKRKRTERSRHGDDDVEKKTRDEQVE 151 >At2g27470.1 68415.m03320 CCAAT-box binding transcription factor subunit HAP3-related contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to polymerase epsilon p17 subunit (DNA polymerase epsilon subunit 3) (YB-like protein 1) (YBL1) (NF-YB-like protein) (SP:Q9JKP7) [Mus musculus]; Length = 275 Score = 32.7 bits (71), Expect = 0.17 Identities = 20/89 (22%), Positives = 37/89 (41%), Gaps = 1/89 (1%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVN-SGSERKSSGKDE 88 N + + D + T E E N EN E + D+ S+ +G+E + SG ++ Sbjct: 181 NGNDEEDENDDENTEENGNDEENDDENTEENGNDEENEKEDEENSMEENGNESEESGNED 240 Query: 87 EYSEQNSSNKSFNDGDASADYQTKSKKVE 1 E+N S ++ + ++VE Sbjct: 241 HSMEENGSGVGEDNENEDGSVSGSGEEVE 269 >At5g61150.2 68418.m07672 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 623 Score = 32.3 bits (70), Expect = 0.22 Identities = 18/71 (25%), Positives = 37/71 (52%) Frame = -3 Query: 219 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 40 + E SES ++ E+E +E E + R +S E + +++E E+ SN+ ++D D Sbjct: 516 QMEYSESEREESEYETEEEEEEKSPARGRGKDSEDEYEEDAEEDE-EERGKSNR-YSDED 573 Query: 39 ASADYQTKSKK 7 + +++K Sbjct: 574 EEEEEGGRAEK 584 >At5g61150.1 68418.m07671 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 625 Score = 32.3 bits (70), Expect = 0.22 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 R +DS+ + + E E+ +SN+ S E E +E + +K+ SG +RK DE Sbjct: 544 RGKDSEDEYEEDAEEDEEERGKSNRYSDEDEEEEEVAGGRAEKDHR-GSGRKRKGIESDE 602 Query: 87 EYS 79 E S Sbjct: 603 EES 605 Score = 31.5 bits (68), Expect = 0.38 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 8/79 (10%) Frame = -3 Query: 219 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE--------RKSSGKDEEYSEQNSS 64 + E SES ++ E+E +E E + R +S E + GK YS+++ Sbjct: 516 QMEYSESEREESEYETEEEEEEKSPARGRGKDSEDEYEEDAEEDEEERGKSNRYSDEDEE 575 Query: 63 NKSFNDGDASADYQTKSKK 7 + G A D++ +K Sbjct: 576 EEEVAGGRAEKDHRGSGRK 594 >At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong similarity to RNA helicase RH26 [Arabidopsis thaliana] GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH26 GI:3776024 Length = 850 Score = 32.3 bits (70), Expect = 0.22 Identities = 20/81 (24%), Positives = 43/81 (53%) Frame = -3 Query: 249 RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQN 70 R+GS++G V+ + SES+ + R N ++ SS +++V+SGS + S + Sbjct: 181 REGSRNG-RVQGKSSESSFRGRSDRNVDSGSSFRGRSDKNVDSGSSFRGRNDRNVDSGSS 239 Query: 69 SSNKSFNDGDASADYQTKSKK 7 +S + D+ + ++ +S + Sbjct: 240 FRGRSDRNVDSGSSFRGRSDR 260 >At4g15030.1 68417.m02309 expressed protein Length = 179 Score = 32.3 bits (70), Expect = 0.22 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = -3 Query: 255 SKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 76 S+ D + E E+SESN+K ++ N+ S Y G RKS K E Sbjct: 102 SEDDTDEEEKRKEGERSESNEKKKQKRNRSQSHSEYDTDEEDRRKGKTRKS--KLESADR 159 Query: 75 QNSSNKSFND 46 + +++F++ Sbjct: 160 EGKDDENFDE 169 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 32.3 bits (70), Expect = 0.22 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = -3 Query: 219 EREKSESNKKSR-EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 43 ER+K + KK R E + +EAE R+K S S+ K K E+ +++ + + Sbjct: 7 ERKKEKKEKKERKERKRREAEELAVREKKISKKHKSKSKEEEKPEKSKKKSKKYEEVEEE 66 Query: 42 DASADYQTKSKK 7 + S KK Sbjct: 67 EKSPSPSPSPKK 78 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = -3 Query: 255 SKRDGSKSGVTVEREKSESN-KKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 SK+ SKS + EKS+ KK E E +E S +S S + K S + E Sbjct: 37 SKKHKSKSKEEEKPEKSKKKSKKYEEVEEEEKSPSPSPSPKKSKESKKKHKRSSDESE 94 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 32.3 bits (70), Expect = 0.22 Identities = 18/71 (25%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = -3 Query: 219 EREKSESNKKSR-EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 43 E+E+ +K R E E E E +DK R K GK+ E++ + + Sbjct: 796 EKERKRDEEKVRKEKERDEKEKRKDKDKERREKEREREKEKGKERSKREESDGETAMDVS 855 Query: 42 DASADYQTKSK 10 + D + K K Sbjct: 856 EGHKDEKRKGK 866 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 31.9 bits (69), Expect = 0.29 Identities = 23/80 (28%), Positives = 34/80 (42%), Gaps = 3/80 (3%) Frame = -3 Query: 258 DSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE--- 88 D D VERE+ E K E KEAE + + N N+G K + E Sbjct: 96 DVSTDKENGDEIVEREEEE--KAVEENNEKEAEGTGNEEGNEDSNNGESEKVVDESEGGN 153 Query: 87 EYSEQNSSNKSFNDGDASAD 28 E S + + ++ DAS++ Sbjct: 154 EISNEEAREINYKGDDASSE 173 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 3/72 (4%) Frame = -3 Query: 264 NEDSKRDGSKSGV---TVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 94 ++D ++ +KS + T E+ S+SN + E + ++ + + S SGS KS+G Sbjct: 231 SDDGEQQETKSELDSKTGEKGFSDSNGELPETNLSTSNATETTESSGSDESGSSGKSTGY 290 Query: 93 DEEYSEQNSSNK 58 + +E++ K Sbjct: 291 QQTKNEEDEKEK 302 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/71 (23%), Positives = 30/71 (42%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 + + S ++ SK E E E S + EN+ E+ + S G+E K + K Sbjct: 358 KEDSSSQEESKEE---EPENKEKEASSSQEENEIKETEIKEKEESSSQEGNENKETEKKS 414 Query: 87 EYSEQNSSNKS 55 S++ + S Sbjct: 415 SESQRKENTNS 425 >At4g08350.1 68417.m01380 KOW domain-containing transcription factor family protein chromatin structural protein homolog Supt5hp - Mus musculus,PID:g2754752 Length = 1029 Score = 31.9 bits (69), Expect = 0.29 Identities = 16/68 (23%), Positives = 32/68 (47%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 R+ED + DG + +E E+ E ++ E S R ++ ++ +E S +D+ Sbjct: 5 RDEDDELDGDYEALDLEEEEEEDEEEEEERGRGGGGSRRKRGRSNFIDDYAEEDSQEEDD 64 Query: 87 EYSEQNSS 64 + + SS Sbjct: 65 DDEDYGSS 72 >At5g64030.1 68418.m08039 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 829 Score = 31.5 bits (68), Expect = 0.38 Identities = 21/84 (25%), Positives = 40/84 (47%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 NED K DG S + +E S+K+ + E KE ++ + + +S ++ ++ G +++ Sbjct: 85 NEDKKGDGDAS---LPKEDESSSKQDNQEEKKEEKTK----EEFTPSSETKSETEGGEDQ 137 Query: 84 YSEQNSSNKSFNDGDASADYQTKS 13 + S N D D D + S Sbjct: 138 KDDSKSENGGGGDLDEKKDLKDNS 161 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Frame = -3 Query: 219 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGS-ERKSSGKDEEYSEQNSSNKSFNDG 43 + E ++N+K + E ++ E + + S + E+KS D++ S+ + NK+ N+ Sbjct: 162 DEENPDTNEKQTKPETEDNELGEDGENQKQFESDNGEKKSIDDDKKSSDDDKENKTGNE- 220 Query: 42 DASADYQTKSKK 7 D +TK++K Sbjct: 221 ----DTETKTEK 228 >At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein contains Pfam PF00096: Zinc finger, C2H2 type Length = 812 Score = 31.5 bits (68), Expect = 0.38 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = -3 Query: 225 TVEREKSESNKKSREFENKEAESSTYR-DKNRSVNSGSERKSSGKDEEYSEQNSSNK-SF 52 TV R +S N + E E + +TYR DK +S G++ S+G ++ + + ++ Sbjct: 701 TVRRLQSSQNPQEEEEEAISKDKNTYRSDKGKSQVVGTDSSSTGSKQQRKKTSKFHRVRL 760 Query: 51 NDGDASA 31 DG +A Sbjct: 761 GDGSMAA 767 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 31.1 bits (67), Expect = 0.51 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 1/87 (1%) Frame = -3 Query: 264 NEDSKRDGSKSGVT-VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 + SKR KSG + +R + + K +K+ + S+ + + R G E K S Sbjct: 70 SSSSKRRKGKSGESGSDRWNGKDDDKGE--SSKKTKVSSEKSRKRDEGDGEETKKSSGKS 127 Query: 87 EYSEQNSSNKSFNDGDASADYQTKSKK 7 + + SS + D D D + K K Sbjct: 128 DGKHRESSRRESKDVDKEKDRKYKEGK 154 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/65 (23%), Positives = 27/65 (41%) Frame = -3 Query: 216 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 37 R++ +++ R + ++ S Y + S ER + +Q+ K DG Sbjct: 367 RDRDRDHERDRTHDREKDRSRDYYHDGKRSKSDRERDNDRDVSRLDDQSGRYKDRRDGRR 426 Query: 36 SADYQ 22 S DYQ Sbjct: 427 SPDYQ 431 >At4g33740.2 68417.m04791 expressed protein Length = 227 Score = 31.1 bits (67), Expect = 0.51 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 4/98 (4%) Frame = -3 Query: 282 NQ*IIRNEDSKRDGSKSGVTVERE-KSESNKKSREFENKEAES---STYRDKNRSVNSGS 115 N+ + ++ + + S G E++ K E+ E E E E DKN+ + Sbjct: 84 NEKHVEEDEDEEEISHGGEEKEKKSKVENGNHEEEVEKDEEEEVAEDDEEDKNKQGEEVA 143 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 E E E + ++S N GD D +T ++ E Sbjct: 144 EEDEEENKHEEDEIDEQDQSKNAGDTDKDDETLEEEKE 181 >At4g33740.1 68417.m04790 expressed protein Length = 227 Score = 31.1 bits (67), Expect = 0.51 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 4/98 (4%) Frame = -3 Query: 282 NQ*IIRNEDSKRDGSKSGVTVERE-KSESNKKSREFENKEAES---STYRDKNRSVNSGS 115 N+ + ++ + + S G E++ K E+ E E E E DKN+ + Sbjct: 84 NEKHVEEDEDEEEISHGGEEKEKKSKVENGNHEEEVEKDEEEEVAEDDEEDKNKQGEEVA 143 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 E E E + ++S N GD D +T ++ E Sbjct: 144 EEDEEENKHEEDEIDEQDQSKNAGDTDKDDETLEEEKE 181 >At3g48120.1 68416.m05248 expressed protein Length = 328 Score = 31.1 bits (67), Expect = 0.51 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTY--RDKNRSVNSGSERKSSGKDE 88 E S R+ S+ RE+ E +K R S+Y R++ RS + +ER++ D Sbjct: 88 ERSYRESSERRRYRSRERDERDKSHRRRSRSSERRSSYVDRERRRSRSRSAERRNRYGDR 147 Query: 87 EYSEQNSSNKSFN 49 E +++ ++S + Sbjct: 148 ESRRRSNRSRSLS 160 Score = 29.9 bits (64), Expect = 1.2 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 2/96 (2%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 112 R+R++ + R + V+RE+ S +S E N+ + + R NRS S S Sbjct: 103 RERDERDKSHRRRSRSSERRSSYVDRERRRSRSRSAERRNRYGDRESRRRSNRS-RSLSP 161 Query: 111 RKSSGKDEEYSEQNSSNKSFNDG--DASADYQTKSK 10 R+ E+ E+ G + SA + K+K Sbjct: 162 RRERRSREDVKEKKPDYSRLIKGYDEMSAAEKVKAK 197 >At1g03530.1 68414.m00334 expressed protein similar to hypothetical protein GB:O14360 Length = 797 Score = 31.1 bits (67), Expect = 0.51 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = -3 Query: 213 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 52 EKS+ K + E+E+S+ + S +S SE + S +DE E+N + F Sbjct: 233 EKSDEAKGEMDSAESESETSS-SSASSSDSSSSEEEESDEDESDKEENKKEEKF 285 >At5g56360.1 68418.m07034 calmodulin-binding protein similar to alpha glucosidase II beta subunit from GI:2104691 [Mus musculus] Length = 647 Score = 30.7 bits (66), Expect = 0.67 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = -3 Query: 168 EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN---KSFNDGDASADYQTKSKKVE 1 E E ++ D+ N E K+E S ++SS+ +S NDG A + + KKVE Sbjct: 281 EGEPTSILDEATHTNPADEHVVERKEESTSSEDSSSPTDESQNDGSAEKEESDEVKKVE 339 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 30.7 bits (66), Expect = 0.67 Identities = 17/70 (24%), Positives = 31/70 (44%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 + DS+ + + E+E+ ++KK +E E +S D N + E+ K E Sbjct: 403 SSDSEDEEEEKEQKAEKEEESTSKKRQEQEETATDSDDESDSNSEKDQEEEQSQLEKARE 462 Query: 84 YSEQNSSNKS 55 S +S + S Sbjct: 463 SSSSSSDSGS 472 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -3 Query: 252 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 103 KR + T ++S+SN + + E + + S +SGSER+S Sbjct: 427 KRQEQEETATDSDDESDSNSEKDQEEEQSQLEKARESSSSSSDSGSERRS 476 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 30.7 bits (66), Expect = 0.67 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = -3 Query: 216 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 40 REK + ++SRE +++ + RD+ R +R G+D + + +++ + GD Sbjct: 269 REKGKERERSRELSHEQPRERS-RDRPREDKHHRDRDQGGRDRDRDSRRDRDRTRDRGD 326 >At3g05060.1 68416.m00549 SAR DNA-binding protein, putative strong similarity to SAR DNA-binding protein-1 [Pisum sativum] GI:3132696; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 533 Score = 30.7 bits (66), Expect = 0.67 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYR--DKNRSVNSGSERKSSGKDE 88 E SK+ K VE EK E + S + + K+AE+ T + + +++K ++E Sbjct: 453 EPSKKKDKKKKKKVEEEKPEEEEPSEKKKKKKAEAETEAVVEVAKEEKKKNKKKRKHEEE 512 Query: 87 EYSEQNSSNK 58 E +E + K Sbjct: 513 ETTETPAKKK 522 >At1g76820.1 68414.m08939 expressed protein Length = 266 Score = 30.7 bits (66), Expect = 0.67 Identities = 15/78 (19%), Positives = 36/78 (46%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 94 ++ +ED++ + + +T K S KKS + + + K S + E S + Sbjct: 114 LLADEDNREEAEDNDITFSGRKKSSKKKSSSVLASIGDEESSQSKT-SDSKSVELVESAR 172 Query: 93 DEEYSEQNSSNKSFNDGD 40 +++ ++N S ++ + D Sbjct: 173 SKKHKKKNKSGRTLQEDD 190 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 30.3 bits (65), Expect = 0.89 Identities = 20/83 (24%), Positives = 33/83 (39%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 R D R+GS+ + +RE+S + + + R+K S S E K E Sbjct: 88 RERDKVREGSRDKES-DRERSSKERDRSDRDKPRDRERREREKRSSSRSRREEKEPEVVE 146 Query: 87 EYSEQNSSNKSFNDGDASADYQT 19 S ++ K + D D +T Sbjct: 147 RGSRRHRDKKDEPEADPERDQRT 169 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 30.3 bits (65), Expect = 0.89 Identities = 21/96 (21%), Positives = 41/96 (42%), Gaps = 2/96 (2%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 112 RD++ R+ + RD KS +REKS + RE +RD++R + Sbjct: 58 RDKDGNKDRDREKDRDREKSRDR-DREKSRDRDRDRERSKDRQRDRHHRDRHRDRSRERS 116 Query: 111 RKSSGKDEEY--SEQNSSNKSFNDGDASADYQTKSK 10 K D+++ ++ + D D ++ +S+ Sbjct: 117 EKRDDLDDDHHRRSRDRDRRRSRDRDREVRHRRRSR 152 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 29.9 bits (64), Expect = 1.2 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = -3 Query: 249 RDGSKSGVTVEREKSES-NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY--- 82 +D KS +++E EK ES NKK R + E S + +S + G K DEE Sbjct: 1525 KDTPKS-LSLEHEKVESRNKKRRSSALPKTEYSGEAGEEKSESEGKSLKEGEDDEEVVNK 1583 Query: 81 SEQNSSNKSFNDGDA 37 E K+ + GDA Sbjct: 1584 EEDLQEAKTESSGDA 1598 >At4g35940.1 68417.m05113 expressed protein Length = 451 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/73 (24%), Positives = 31/73 (42%) Frame = -3 Query: 219 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 40 E+ K E +K R + K+ + R + + ++ GK E SE+ S + + Sbjct: 32 EKAKKEQRRKDRRSDKKDKKDKKERKEKKEKKEKKRKEREGK-EVGSEKRSHKRRRKEDG 90 Query: 39 ASADYQTKSKKVE 1 A D K K+ E Sbjct: 91 AKVDLFHKLKESE 103 >At3g25840.1 68416.m03219 protein kinase family protein contains Pfam profile: PF00069 eukaryotic protein kinase domain Length = 935 Score = 29.9 bits (64), Expect = 1.2 Identities = 19/80 (23%), Positives = 35/80 (43%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 R+ +RD + G +R+ S ++ ++ + + R+K R + S ER+ K+ Sbjct: 255 RDRSKERDMDREGSIRDRDSEGSKRRDKDSDRRRERE---REKRREIESDRERRKE-KER 310 Query: 87 EYSEQNSSNKSFNDGDASAD 28 E S K +GD D Sbjct: 311 ERSIDRDRRKE-REGDYLRD 329 >At2g34300.1 68415.m04196 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = -3 Query: 213 EKSESNKKSREFENKEAESSTYRDKN-RSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 37 EK+E+ ++ +E ++ + ++KN + V S S+ + + + E NKS DG+ Sbjct: 112 EKTEAGEERKESDDNNGDGDGEKEKNVKEVGSESDETTQKEKTQLEESTEENKS-EDGNG 170 Query: 36 SAD 28 + + Sbjct: 171 NEE 173 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/98 (20%), Positives = 40/98 (40%), Gaps = 7/98 (7%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNR-------SVNSGS 115 + +N+ K +G + EK+E N+ + E + +S + N+ +G Sbjct: 59 VSKNDLRKEEGDRDPKNFSDEKNEENEAATENNQVKTDSENSAEGNQVNESSGEKTEAGE 118 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 ERK S D K+ + + +D T+ +K + Sbjct: 119 ERKES-DDNNGDGDGEKEKNVKEVGSESDETTQKEKTQ 155 >At5g62750.1 68418.m07877 expressed protein predicted proteins, Caenorhabditis elegans Length = 124 Score = 29.5 bits (63), Expect = 1.5 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = -3 Query: 204 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADY 25 E+ +K + +NKE E N++ + E+K KD++ ++N +K+ G+ D Sbjct: 3 ETEEKVKNHDNKEEEH------NKAEKA--EKKEKKKDKDKKDKNEDDKN-GGGEEGEDQ 53 Query: 24 QTKSKK 7 + KSKK Sbjct: 54 EKKSKK 59 >At4g00990.1 68417.m00133 transcription factor jumonji (jmjC) domain-containing protein contains Pfam domain, PF02373: jmjC domain Length = 840 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/71 (23%), Positives = 37/71 (52%) Frame = -3 Query: 219 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 40 +++ +E+ + +++ + E+S +N+S+ E K KD+ +E+ S+N S G Sbjct: 576 QKKYAEAMLQKQQYSGQVKEASEL--ENKSMKEVDESKKDLKDKAANEEQSNNSSRPSGS 633 Query: 39 ASADYQTKSKK 7 A+ SK+ Sbjct: 634 GEAEKVIISKE 644 >At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 371 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = -3 Query: 219 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 40 ERE+ E+ +K++ NKEAE+ T + + S E +D++ + + ++ + Sbjct: 296 EREQEETEQKAK---NKEAEAGTSKSSGDAEQSSKEVNEEEEDDDDDDDDLDMDELDELE 352 Query: 39 AS 34 AS Sbjct: 353 AS 354 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -3 Query: 183 EFEN-KEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 40 E+E +E E + + KN+ +G+ KSSG E+ S++ + + +D D Sbjct: 292 EYEREREQEETEQKAKNKEAEAGTS-KSSGDAEQSSKEVNEEEEDDDDD 339 >At1g03320.1 68414.m00311 hypothetical protein Length = 220 Score = 29.5 bits (63), Expect = 1.5 Identities = 22/75 (29%), Positives = 39/75 (52%) Frame = -3 Query: 285 RNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK 106 + Q + +NE+ K+D + E+ E +KK++ +SST ++K N SE + Sbjct: 33 QKQKVSKNENPKKDSNG-----EKGSDEKDKKNKNVLRWPQDSSTKKEKGDGKNLSSE-E 86 Query: 105 SSGKDEEYSEQNSSN 61 + GK+ SE+N N Sbjct: 87 NGGKNLP-SEKNGVN 100 >At1g01440.1 68414.m00059 extra-large G-protein-related weak similarity to extra-large G-protein (AtXLG1) (GI:3201682) [Arabidopsis thaliana] Length = 664 Score = 29.5 bits (63), Expect = 1.5 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (4%) Frame = -3 Query: 252 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS--GSER--KSSGKDEE 85 + G G +S+ ++ +E N+ A +S R++ NS GS+R KSS K+EE Sbjct: 2 RTSGDVYGADTGSSRSDEDRGFKEDLNESA-TSPMRNRLDDSNSRPGSQRFVKSSRKEEE 60 Query: 84 YSEQNSSNKSFNDGDASADYQTKSK 10 +SS+K+ + Y K + Sbjct: 61 TDSDSSSSKNTTTRNNPIQYTDKQQ 85 >At5g58880.1 68418.m07377 hypothetical protein Length = 1088 Score = 29.1 bits (62), Expect = 2.0 Identities = 22/77 (28%), Positives = 41/77 (53%) Frame = -3 Query: 240 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 61 ++ + +E E + +++ KEA T D ++SV S RKS K+ E +++ SN Sbjct: 363 TRKRLDLENEYIDHTEQNLPLNGKEA---TIEDDDKSVVS---RKSEEKEVEMNDETDSN 416 Query: 60 KSFNDGDASADYQTKSK 10 K D D+S +++S+ Sbjct: 417 KEECD-DSSCSEESESE 432 >At5g12230.1 68418.m01435 expressed protein Length = 221 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/87 (19%), Positives = 44/87 (50%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 ++E RD K +R+K + +++ ++ ++K + S +DK++ + ++ Sbjct: 119 KSESKDRD-RKHKKHKDRDK-DKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSG 176 Query: 87 EYSEQNSSNKSFNDGDASADYQTKSKK 7 ++S+++ K +DGD + + KK Sbjct: 177 DHSKKHHDKKRKHDGDEDLNDVQRHKK 203 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.1 bits (62), Expect = 2.0 Identities = 21/77 (27%), Positives = 34/77 (44%) Frame = -3 Query: 237 KSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 58 K VE+E + + ++K+ +DKNR N K S ++E S+ N S+ Sbjct: 729 KDSEQVEKEDNSDLDANLSCDSKDTIRHQIKDKNRRKN-----KRSSREEVSSDDNGSSD 783 Query: 57 SFNDGDASADYQTKSKK 7 S D A + K +K Sbjct: 784 SDVDDRKEAKRRRKEEK 800 >At2g12875.1 68415.m01402 hypothetical protein Length = 325 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = -3 Query: 210 KSESNKKSREFENK--EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 37 K+ + + S +NK EA DKN S + + ++EE SE+ + +DG+ Sbjct: 92 KATTEEPSSTEQNKAIEAVKEDKYDKNEEEKSEKDEQEKSEEEE-SEEEEKEEGNDDGEE 150 Query: 36 SADYQTKSKK 7 S++ T +++ Sbjct: 151 SSNDSTTTEE 160 >At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calreticulin (crt1) GI:2052379 [Arabidopsis thaliana] Length = 425 Score = 29.1 bits (62), Expect = 2.0 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -3 Query: 204 ESNKKSREFENKEA--ESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 31 E+ KK E E+K+A ES + N G + + K EE E + K + DA+ Sbjct: 364 EAEKKREEEESKDAPAESDAEEEAEDDDNEGDDSDNESKSEETKEAEET-KEAEETDAAH 422 Query: 30 D 28 D Sbjct: 423 D 423 >At1g56110.1 68414.m06443 nucleolar protein Nop56, putative similar to XNop56 protein [Xenopus laevis] GI:14799394; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 522 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/92 (18%), Positives = 39/92 (42%), Gaps = 2/92 (2%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKN--RSVNSGSERKSSG 97 ++ E+ ++ + V ++K ++ E E + S + K R + + E + S Sbjct: 431 LKQEEEGKEPVDASVKKSKKKKAKGEEEEEVVAMEEDKSEKKKKKEKRKMETAEENEKSE 490 Query: 96 KDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 K + + + +DG ++ + KSK E Sbjct: 491 KKKTKKSKAGGEEETDDGHSTKKKKKKSKSAE 522 >At1g07980.1 68414.m00869 histone-like transcription factor (CBF/NF-Y) family protein contains Pfam profile PF00808: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to Chromatin accessibility complex protein 1 (CHRAC-1) (CHRAC-15) (HuCHRAC15) (DNA polymerase epsilon subunit p15) (SP:Q9NRG0) {Homo sapiens} Length = 206 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/77 (20%), Positives = 34/77 (44%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 R+ S+ + + V + ++K E + S + E + D+ + N ++ +GK Sbjct: 27 RSSGSRTKKTSNKVNIVKKKPEIYEISESSSSDSVEEAIRGDEAKKSNGVVSKRGNGKSV 86 Query: 87 EYSEQNSSNKSFNDGDA 37 + S N+ +DG A Sbjct: 87 GIPTKTSKNREEDDGGA 103 >At5g50840.2 68418.m06299 expressed protein Length = 405 Score = 28.7 bits (61), Expect = 2.7 Identities = 21/79 (26%), Positives = 38/79 (48%) Frame = -3 Query: 258 DSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 79 +SKR GSK+ E+E E K ++ ++ + T RDK S+ +R++ EE Sbjct: 125 ESKRKGSKNMFKSEKEFLEFMLKYQQVLSERDSAITVRDKLESLCRELQRQNKMLMEECK 184 Query: 78 EQNSSNKSFNDGDASADYQ 22 ++ ++ D S +Q Sbjct: 185 RVSTEGQTLR-SDLSTKFQ 202 >At5g50840.1 68418.m06298 expressed protein Length = 404 Score = 28.7 bits (61), Expect = 2.7 Identities = 21/79 (26%), Positives = 38/79 (48%) Frame = -3 Query: 258 DSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 79 +SKR GSK+ E+E E K ++ ++ + T RDK S+ +R++ EE Sbjct: 124 ESKRKGSKNMFKSEKEFLEFMLKYQQVLSERDSAITVRDKLESLCRELQRQNKMLMEECK 183 Query: 78 EQNSSNKSFNDGDASADYQ 22 ++ ++ D S +Q Sbjct: 184 RVSTEGQTLR-SDLSTKFQ 201 >At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 587 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -3 Query: 219 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNS 67 +R K ++ K +FE KEA+ R K R N E + G D++ E+ + Sbjct: 37 KRRKRKTVKLYEDFEEKEAD----RKKKRKGNKEDEDMAEGDDDQAEEETN 83 >At1g78580.1 68414.m09158 alpha, alpha-trehalose-phosphate synthase, UDP-forming, putative / trehalose-6-phosphate synthase, putative / UDP-glucose-glucosephosphate glucosyltransferase, putative similar to trehalose-6-phosphate synthase SL-TPS/P [Selaginella lepidophylla] GI:4100325; contains Pfam profiles PF00982: Glycosyltransferase family 20, PF02358: Trehalose-phosphatase Length = 942 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG--SERKS 103 I R+ S G+KS R S+S + + +K + SS + N+S SERKS Sbjct: 819 IARSRPSSDSGAKSSSGDRRPPSKSTHNNNKSGSKSSSSSNSNNNNKSSQRSLQSERKS 877 >At1g75310.1 68414.m08748 DNAJ heat shock N-terminal domain-containing protein low similarity to SP|Q27974 Auxilin {Bos taurus}; contains Pfam profile PF00226: DnaJ domain Length = 1448 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 1/85 (1%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTV-EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 97 ++++E+S +G+ V E E + ++ E+K +E + ++ + +ER S Sbjct: 530 MVQDEESDSQEMLAGIPVIETYLREVEETPQQTESK-SEMNIEEKSESTICAFTERSSQN 588 Query: 96 KDEEYSEQNSSNKSFNDGDASADYQ 22 ++E Q S F DG D+Q Sbjct: 589 MEKETGWQVKSACKFEDGSGVKDFQ 613 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = -3 Query: 216 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSER---KSSGKDEEYSEQNSSNKSFND 46 +E S S + + E++ +E + V S +E+ K KDEE E+N + K+ Sbjct: 4545 KEYSVSEDEEEDKEDEGSEDEPLDNGIGDVGSDAEKADEKPWNKDEEDEEENMNEKN-ES 4603 Query: 45 GDASADYQTKSKKV 4 G + D T+S+++ Sbjct: 4604 GPSIVDKDTRSREL 4617 >At1g51745.1 68414.m05831 expressed protein Length = 635 Score = 28.7 bits (61), Expect = 2.7 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 2/85 (2%) Frame = -3 Query: 261 EDSKRDGSK--SGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 E +K SK SG RE + +N E E+ E N S S+R SGK++ Sbjct: 88 EKAKASSSKKRSGKCTLREDAINNALKIENEHLAKEDDNLC--NLSGEEDSKRCLSGKED 145 Query: 87 EYSEQNSSNKSFNDGDASADYQTKS 13 E S + + ++ +D ASA Q +S Sbjct: 146 EDSGSSDAEETEDDELASAPEQLQS 170 >At1g21630.1 68414.m02708 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain; ESTs gb|T44428 and gb|AA395440 come from this gene Length = 1218 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVN---SGSERKSSGKD 91 EDS++ K+ R+K+ S S+ + EA+SS RS N G S+GK Sbjct: 832 EDSEQSEGKTSDVDARDKNGSLDDSKVRKGIEADSSPRTKDTRSENGHDDGESTASAGKT 891 Query: 90 EEYSEQNSSN 61 Y + ++ Sbjct: 892 VNYDSHDETD 901 >At5g65490.1 68418.m08236 expressed protein similar to unknown protein (dbj BAA75199.1) Length = 643 Score = 28.3 bits (60), Expect = 3.6 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Frame = -3 Query: 216 REKSESNKKSREFENKEAESSTYRDKNRSV---NSGSERKSSGKD--EEYSEQNSSNKSF 52 +E S+ S ++ ++ +S +++ + + NS ERK+ GK+ E S +++ +F Sbjct: 398 QEVPASDNDSWLYDGEDELNSVLQERQKEMEFYNSKKERKNKGKEKQEAGSSSDANMNNF 457 Query: 51 NDGDASADYQTKSKKV 4 + GD S Q KV Sbjct: 458 DLGDISKSMQQFMHKV 473 >At5g61330.1 68418.m07696 rRNA processing protein-related contains weak similarity to rRNA processing protein EBP2 (EBNA1-binding protein homolog) (Swiss-Prot:P36049) [Saccharomyces cerevisiae] Length = 436 Score = 28.3 bits (60), Expect = 3.6 Identities = 23/94 (24%), Positives = 37/94 (39%), Gaps = 4/94 (4%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVTVEREKSESNKKSREFENKE---AESSTYRDKN-RSVNSGSERKS 103 + +++ + + G T E ++ +S + E ENKE ES + D N + SG E Sbjct: 49 MEDDEGESEEDDEGDTEEDDEGDSEEDD-EGENKEDEDGESEDFEDGNDKESESGDEGND 107 Query: 102 SGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 KD + E K + K K E Sbjct: 108 DNKDAQMEELEKEVKELRSQEQDILKNLKRDKGE 141 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 28.3 bits (60), Expect = 3.6 Identities = 21/85 (24%), Positives = 35/85 (41%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 82 ++ D KS ER+K +S K + E E E K+ + + K KDE+ Sbjct: 170 KEKLEDEQKSADRKERKKKKSKKNNDEDVVDEKEKLEDEQKSAEI----KEKKKNKDEDV 225 Query: 81 SEQNSSNKSFNDGDASADYQTKSKK 7 ++ K D S + + + KK Sbjct: 226 VDEKEKEK-LEDEQRSGERKKEKKK 249 >At4g25880.2 68417.m03722 pumilio/Puf RNA-binding domain-containing protein contains Pfam profile:PF00806 Pumilio-family RNA binding domains Length = 852 Score = 28.3 bits (60), Expect = 3.6 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 6/85 (7%) Frame = -3 Query: 240 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS------ERKSSGKDEEYS 79 S+ ++ +E SE + N ++ + D S S S + SSG+ ++S Sbjct: 118 SQGKLSTHKEVSEDESSQQLSVNSVSDRTDGLDIRLSPGSQSLADFRQDDTSSGQTPQHS 177 Query: 78 EQNSSNKSFNDGDASADYQTKSKKV 4 NSSN N D S ++ S V Sbjct: 178 RSNSSNGEVNTADESGNFSELSDDV 202 >At4g25880.1 68417.m03721 pumilio/Puf RNA-binding domain-containing protein contains Pfam profile:PF00806 Pumilio-family RNA binding domains Length = 861 Score = 28.3 bits (60), Expect = 3.6 Identities = 22/85 (25%), Positives = 36/85 (42%), Gaps = 6/85 (7%) Frame = -3 Query: 240 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS------ERKSSGKDEEYS 79 S+ ++ +E SE + N ++ + D S S S + SSG+ ++S Sbjct: 118 SQGKLSTHKEVSEDESSQQLSVNSVSDRTDGLDIRLSPGSQSLADFRQDDTSSGQTPQHS 177 Query: 78 EQNSSNKSFNDGDASADYQTKSKKV 4 NSSN N D S ++ S V Sbjct: 178 RSNSSNGEVNTADESGNFSELSDDV 202 >At4g02110.1 68417.m00282 BRCT domain-containing protein contains Pfam domain, PF00533: BRCA1 C Terminus (BRCT) domain Length = 1293 Score = 28.3 bits (60), Expect = 3.6 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 10/95 (10%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSER--------- 109 +D+K K G+ VER +S KK + +SS + K SG+E Sbjct: 935 DDNKCKHGKEGI-VERSSLQSGKKGSSSRVEVGKSSVKKTKKSEKGSGTEATDTVMKDVG 993 Query: 108 -KSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKK 7 S+ + E + N S K + GD S + K K Sbjct: 994 DNSAKEKENIAVDNESRKVGSGGDQSPVARKKVAK 1028 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/74 (24%), Positives = 32/74 (43%), Gaps = 4/74 (5%) Frame = -3 Query: 237 KSGVTVERE----KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQN 70 K +T+E++ + E +K E E KE + S R+K + K GK+++ E + Sbjct: 520 KEIITLEKQVKLLEEEEKEKREEEERKEKKRSKEREKKLRKKERLKEKDKGKEKKNPECS 579 Query: 69 SSNKSFNDGDASAD 28 + N D Sbjct: 580 DKDMLLNSSREEED 593 >At2g32250.2 68415.m03942 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282; contains Pfam:PF03101 domain: FAR1 family Length = 805 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 N D + S SG + + +FE+KEA YR+ RSV G K+S + + Sbjct: 16 NVDVFCEASTSGNVAQCATVSELRNGMDFESKEAAYYFYREYARSVGFGITIKASRRSK 74 >At2g32250.1 68415.m03941 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282; contains Pfam:PF03101 domain: FAR1 family Length = 807 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/59 (30%), Positives = 27/59 (45%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 N D + S SG + + +FE+KEA YR+ RSV G K+S + + Sbjct: 16 NVDVFCEASTSGNVAQCATVSELRNGMDFESKEAAYYFYREYARSVGFGITIKASRRSK 74 >At2g24440.1 68415.m02921 expressed protein Length = 183 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/67 (23%), Positives = 29/67 (43%) Frame = -3 Query: 258 DSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 79 D+KRDGS S + + +K+ + +N A + + +V E + E Sbjct: 31 DTKRDGSSSKLMKIESPEKKKRKTTKAKNVGAAKKKVKKEEVAVKIEKEEEEDDDAAEKE 90 Query: 78 EQNSSNK 58 E + S+K Sbjct: 91 EDDDSDK 97 >At1g70505.1 68414.m08114 expressed protein Length = 338 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -3 Query: 243 GSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 G S V++ R +S N ++R + E TYR + NS + SSG D E Sbjct: 148 GLGSLVSIYRFRSPDNGENR-VSIVDEEQGTYRPPGNAENSNVFKSSSGHDRE 199 >At1g32150.1 68414.m03955 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 389 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 5/82 (6%) Frame = -3 Query: 258 DSKRDGSKSGVTVEREKSESNKKSREF-ENKEAESSTYRDKN----RSVNSGSERKSSGK 94 D K K + ++R K + +N EA ++ N +S SGS+ S G Sbjct: 138 DGKPSDGKEKLPIKRSKGSLGSLNMIIGKNNEAGKNSGASANGACSKSAESGSDGSSDGS 197 Query: 93 DEEYSEQNSSNKSFNDGDASAD 28 D + S + DG+ +++ Sbjct: 198 DANSQNDSGSRHNGKDGETASE 219 >At1g21390.1 68414.m02676 expressed protein Length = 248 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -3 Query: 192 KSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 79 + +E+ N+ +ESST R + S N+ +SS +DE+ S Sbjct: 185 EDKEWWNRMSESSTKRSGSSSSNNSIRSRSSLRDEKSS 222 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 28.3 bits (60), Expect = 3.6 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 13/84 (15%) Frame = -3 Query: 213 EKSESNKKSREFENKEAESSTYRDKNR-------SVNSGSERKSSGKDE-----EYSEQ- 73 E+ S E E +E E RDK R S NSG R S ++E EY +Q Sbjct: 471 EEGGSEYGGYEDETQEKEEKPSRDKERATTERDWSENSGDRRHKSHREEKDSHREYKQQR 530 Query: 72 NSSNKSFNDGDASADYQTKSKKVE 1 + + F+ G +S +++S+ E Sbjct: 531 DRDSDEFDRGQSSLKSRSRSRMSE 554 >At5g44690.1 68418.m05476 hypothetical protein Length = 684 Score = 27.9 bits (59), Expect = 4.7 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNK-KSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 91 RNE+ ++ + +E +S + S ++E + T R R SG E KSS D Sbjct: 369 RNEERRKKEEGKSMEIEEYRSNPQEVTSVVCLDREKDEETARQVFRE--SGKEEKSSQND 426 Query: 90 EEYSE 76 EE S+ Sbjct: 427 EETSK 431 >At3g07120.1 68416.m00848 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 360 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/76 (22%), Positives = 32/76 (42%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 +ED + SG T E + S +++ + + T +R + R + +DEE Sbjct: 231 DEDDDDEEDDSGETEEMKSSSASEPKQTMSLMDLLEET----DRQMGLTGSRYAMDEDEE 286 Query: 84 YSEQNSSNKSFNDGDA 37 Y E + +GD+ Sbjct: 287 YEEDEEDENNEEEGDS 302 >At1g74830.1 68414.m08670 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593 Length = 542 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -3 Query: 207 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 SE K+ E + EAE YR+K + + + EE+ +QN + +++D Sbjct: 378 SELAKREEEMKELEAEFEVYREKYGCLTDQEDAR-----EEFHKQNGNASAYDD 426 >At1g19880.1 68414.m02493 regulator of chromosome condensation (RCC1) family protein low similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 538 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = -1 Query: 338 DDSDKNR---GKDTDDKYSETGTNKSSETKTASVMARRAASQSKG 213 D+SDK + G D D YSE G + + ++A R ++ +G Sbjct: 471 DNSDKEKEVQGSDADSDYSEDGEEANGKKQSARGRGRGRGARGRG 515 >At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative strong similarity to gi:4467359 Length = 1116 Score = 27.5 bits (58), Expect = 6.2 Identities = 21/85 (24%), Positives = 35/85 (41%), Gaps = 5/85 (5%) Frame = -3 Query: 267 RNEDSK-----RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 103 +NED K D K G + K + ++K E E + + Y D+ ++G E Sbjct: 365 KNEDDKVSNAVDDEEKDGFLKKLFKEKFDEKRNGNERNETDETVYTDETSGEDNGREGFF 424 Query: 102 SGKDEEYSEQNSSNKSFNDGDASAD 28 +E E + +DG+ S D Sbjct: 425 KKLFKEKFEDKPNIGKADDGNESED 449 >At4g18830.1 68417.m02779 ovate family protein 52% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 349 Score = 27.5 bits (58), Expect = 6.2 Identities = 22/70 (31%), Positives = 35/70 (50%) Frame = -3 Query: 255 SKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 76 SK GS S + +EK + K S+ K + SST R + NS ++ S ++E S Sbjct: 28 SKLSGS-SDLKPAKEKKQDEKASQNISVKTSLSSTTRRSDIHENSKRFQRVS-VEKENSA 85 Query: 75 QNSSNKSFND 46 S++K N+ Sbjct: 86 TRSADKESNE 95 >At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28) identical to cDNA DEAD box RNA helicase, RH28 GI:3776026 Length = 789 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 273 IIRN-EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNR 133 +IRN EDS + K G E E E E+E ++ + +K + Sbjct: 17 LIRNQEDSSEEDVKEGEAEEHEAGEDEDGEEEYEEEDDDEEEEDEKRK 64 >At4g12610.1 68417.m01987 transcription initiation factor IIF alpha subunit (TFIIF-alpha) family protein low similarity to SP|Q05913 Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) (Transcription factor 5, large chain) (TF5A) {Drosophila melanogaster}; contains Pfam profile PF05793: Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Length = 543 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 NE+ + SKSG +++ ++N E+ + +S + N + S++K + K+E Sbjct: 330 NEEEEGGLSKSGKELKKLLGKANGLDESDEDDDDDSDDEEETNYGTVTNSKQKEAAKEE 388 >At3g50550.1 68416.m05528 expressed protein isoform contains a non-consensus AT donor site at intron 1 Length = 95 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/69 (21%), Positives = 28/69 (40%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 +ED D G + + E E ++ ++ E+ Y D N + E ++EE Sbjct: 18 DEDDDDDDDTDGESSD-EDDEEEDRNLSGDDSESSEDDYTDSNSDSDDDDEEDDDDEEEE 76 Query: 84 YSEQNSSNK 58 E + +K Sbjct: 77 EEEDSLVDK 85 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/54 (18%), Positives = 25/54 (46%) Frame = -3 Query: 207 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 +++N + N + + +D N + N+ + ++G D + N +N N+ Sbjct: 82 NDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNNN 135 >At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing protein contains Pfam domain PF03194: LUC7 N_terminus Length = 402 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/73 (23%), Positives = 37/73 (50%), Gaps = 5/73 (6%) Frame = -3 Query: 213 EKSESNK-KSREFENKEAESSTYRDK----NRSVNSGSERKSSGKDEEYSEQNSSNKSFN 49 EK+ K +S+E +KE ESS R+K +R +R+S +D + ++ ++ Sbjct: 311 EKANIRKERSKERNSKERESSKDREKEQETSREHRRDYDRRSRDRDRHHDRDREQDRDYD 370 Query: 48 DGDASADYQTKSK 10 + + +++S+ Sbjct: 371 RSHSRSRRRSRSR 383 >At2g38550.1 68415.m04736 expressed protein contains Pfam profile PF03647: Uncharacterised protein family (UPF0136) Length = 335 Score = 27.5 bits (58), Expect = 6.2 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 4/97 (4%) Frame = -3 Query: 282 NQ*IIRNEDSKRDGSKSGVTVEREKSE---SNKKSREFENKEAESSTYR-DKNRSVNSGS 115 N+ ++ S D +SGV V +EKS+ + S+E + ES + K +SV+S + Sbjct: 68 NRSVVAFAASHEDSGESGVEVGKEKSDIDVEDDTSKEAWKQTLESFKEQVSKMQSVSSEA 127 Query: 114 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 4 +S K ++ S A + TK+K V Sbjct: 128 YSVNSQKAMTVLKETSEQLRIQAEKAKEELGTKAKVV 164 >At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50) identical to DNA repair-recombination protein GI:7110148 from [Arabidopsis thaliana] Length = 1316 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/71 (23%), Positives = 28/71 (39%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 91 I + +D K G++ E+ E + S EFE + ++ + V ERK+ Sbjct: 440 IEAQKRAKDEIKMGISKRIEEKEIERDSFEFEISTVDVKQTDEREKQVQVELERKTKQNS 499 Query: 90 EEYSEQNSSNK 58 E E K Sbjct: 500 ERGFESKIEQK 510 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 27.5 bits (58), Expect = 6.2 Identities = 19/86 (22%), Positives = 36/86 (41%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 + SK+D +K+G + EK +++ E + + ++ ++ V ++ GKDE Sbjct: 916 SSSSKKD-TKTGEDKKAEKKNNSETMSEGKKIDRNNTDEKEVKEKVTEKEIKERGGKDES 974 Query: 84 YSEQNSSNKSFNDGDASADYQTKSKK 7 + K A QTK K Sbjct: 975 RIQVKDRKKCEEPPRAGFILQTKRNK 1000 >At1g69070.1 68414.m07903 expressed protein Length = 901 Score = 27.5 bits (58), Expect = 6.2 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = -3 Query: 261 EDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 82 ED + G V +ERE + N +S E E+ E+E D + + G E++ G E Sbjct: 336 EDKPKRGWIDDV-LEREDNVDNSESDEDEDSESEEE--EDDDGESDGGDEKQRKGHHLED 392 Query: 81 SEQN 70 EQ+ Sbjct: 393 WEQS 396 >At1g35660.1 68414.m04432 expressed protein Length = 1155 Score = 27.5 bits (58), Expect = 6.2 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 10/81 (12%) Frame = -3 Query: 255 SKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRD-KNRSVNSGSERKSSGKDEEYS 79 S S S + R S K +R+ ++K S RD ++ VN E KS ++E+ S Sbjct: 738 SGSSASSSNGSSARTVPHSRKHNRKLQSKNVASKVSRDVEDERVNFKVENKSRKEEEDTS 797 Query: 78 ---------EQNSSNKSFNDG 43 EQN SN G Sbjct: 798 GETKGAVRLEQNESNSKETPG 818 >At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 327 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -3 Query: 162 ESSTYRDKNRSVNSGSERKSSGKDEEYSE 76 ++ + R+ RS + GSER+ GK++E+ E Sbjct: 288 QARSSREGYRSGSVGSERRGKGKEKEFGE 316 >At5g66950.1 68418.m08440 expressed protein Length = 870 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -3 Query: 216 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 REKS+ N R N++ S R RSV+ G S DE+ E S+ ++D Sbjct: 631 REKSQYNG-GRLLVNEDEHPSKRRVSFRSVDHGEASVISLGDEDEEEDGSNGVEWDD 686 >At5g59730.1 68418.m07487 exocyst subunit EXO70 family protein leucine zipper-containing protein, Lycopersicon esculentum, PIR:S21495 contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 634 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = -3 Query: 222 VEREKSESNKKSREFENKEAES-STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 46 +E E K +RE+ + E S +YR S ++ + S + Y E F+ Sbjct: 102 LESEFHRVLKANREYLDPECVSVRSYRSSRFSTSTTTSVSDSEDESSYEENADEEHRFSG 161 Query: 45 GDASA 31 GD+ A Sbjct: 162 GDSDA 166 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 27.1 bits (57), Expect = 8.3 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Frame = -3 Query: 234 SGVTVEREKSESN----KKSREFENKEAES-STYRDKNRSVNSGSERKSSGKDEEYSEQN 70 SG V+ K E + K + E K+ E S DK V E+K G+D+E E + Sbjct: 37 SGKEVQESKKEEDTGLEKMEIDDEGKQHEGESETGDKEVEVTE-EEKKDVGEDKEQPEAD 95 Query: 69 SSNKSFNDGDASAD 28 ++ +D + AD Sbjct: 96 KMDEDTDDKNLKAD 109 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/82 (21%), Positives = 36/82 (43%) Frame = -3 Query: 291 RDRNQ*IIRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 112 +D N+ ++ +++ S E+E+S + K E KE + DK + S Sbjct: 243 KDENEDKEEEKEDEKEESMDDKEDEKEESNDDDKEDE---KEESNDDKEDKKEDIKK-SN 298 Query: 111 RKSSGKDEEYSEQNSSNKSFND 46 ++ GK E+ + S++ D Sbjct: 299 KRGKGKTEKTRGKTKSDEEKKD 320 >At5g37010.1 68418.m04438 expressed protein Length = 637 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 189 SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE--QNSSNKSFNDGD 40 SRE ++ ++ S R++ S N G R+ S SE NSS S N + Sbjct: 186 SRERDDSKSNRSGSRERGSSGNGGGSRRVSRSPGRRSEINPNSSGNSVNSSN 237 >At5g22450.1 68418.m02618 expressed protein Length = 1180 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/84 (21%), Positives = 31/84 (36%), Gaps = 2/84 (2%) Frame = -3 Query: 273 IIRNEDSKRDGSKSGVTVEREKSESNKKSRE--FENKEAESSTYRDKNRSVNSGSERKSS 100 +I SK SK + ++ + RE F NK + N + N +S Sbjct: 1045 VIGCASSKVTTSKGSAVLSGGGAQGKRSEREDGFRNKNKPKPKENNNNNNGNQSRSTTTS 1104 Query: 99 GKDEEYSEQNSSNKSFNDGDASAD 28 + + +SN+ GD + D Sbjct: 1105 THPTGPASRGASNRGVTSGDGAVD 1128 >At4g37210.2 68417.m05267 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q02508 Protein HGV2 Halocynthia roretzi; contains Pfam profile PF00515 TPR Domain Length = 377 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -3 Query: 216 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 37 +++ E ++S E+ A S D R +S + S GKD+ ++ + +D D Sbjct: 148 KKEGEVQQESSNGESL-APSVVSGDPERQGSSSGQEGSGGKDQGEDGEDCQDDDLSDADG 206 Query: 36 SAD 28 AD Sbjct: 207 DAD 209 >At4g37210.1 68417.m05268 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q02508 Protein HGV2 Halocynthia roretzi; contains Pfam profile PF00515 TPR Domain Length = 492 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -3 Query: 216 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 37 +++ E ++S E+ A S D R +S + S GKD+ ++ + +D D Sbjct: 148 KKEGEVQQESSNGESL-APSVVSGDPERQGSSSGQEGSGGKDQGEDGEDCQDDDLSDADG 206 Query: 36 SAD 28 AD Sbjct: 207 DAD 209 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/89 (19%), Positives = 43/89 (48%), Gaps = 4/89 (4%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS--VNSGSERKSSG 97 + ++D+K D + + ++ E +K S++ + R+KN++ V +E ++ Sbjct: 256 VESKDAKEDEKEETNDDKEDEKEESKGSKKRGKGTSSGGKVREKNKTEEVKKDAEPRTPF 315 Query: 96 KDEEYSEQNSSNK--SFNDGDASADYQTK 16 D E+ S + + D D+S +++ + Sbjct: 316 SDRPVRERKSVERLVALIDKDSSKEFRVE 344 >At3g60110.1 68416.m06712 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 438 Score = 27.1 bits (57), Expect = 8.3 Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 2/90 (2%) Frame = -3 Query: 264 NEDSKRDGSKSG--VTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 91 ++D K + SK+ +++KS ++ R +N + KN+ N G+ +K + Sbjct: 307 DDDEKEENSKTEKKTVADKKKSVADFLKRIKKNSPQKGKETTSKNQKKNDGNVKKENDHQ 366 Query: 90 EEYSEQNSSNKSFNDGDASADYQTKSKKVE 1 ++ S+ N ++ T KKVE Sbjct: 367 KK-SDGNVKKENSKVKPRELRSSTGKKKVE 395 >At3g11590.1 68416.m01416 expressed protein Length = 622 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -3 Query: 198 NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 52 N+++ ++ N +Y ++ V +G+E S D E N NKS+ Sbjct: 461 NEEAGDYLNHHISFGSYNIEDGEVENGNEEGSGESDLHSIELNIDNKSY 509 >At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 566 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = -3 Query: 243 GSKSGVTVEREKSESNK--KSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 85 G G E + E +K +S F N AE T++D + V R G DE+ Sbjct: 85 GWGDGCCREPNEEEESKVVRSYNFNNMGAEEETWQDMRKRVLQKLHRLFGGSDED 139 >At2g44200.1 68415.m05500 expressed protein Length = 493 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/93 (20%), Positives = 38/93 (40%), Gaps = 5/93 (5%) Frame = -3 Query: 270 IRNEDSKRDGSKSGVTVEREKSESNKKSRE-----FENKEAESSTYRDKNRSVNSGSERK 106 + +E R+ R + + K RE +E + +E + S ++ ER+ Sbjct: 236 LEDESKGRESRDRHYEKRRSELDDGHKRRERHDTHYERRRSEMDDESKRRESRDNHYERR 295 Query: 105 SSGKDEEYSEQNSSNKSFNDGDASADYQTKSKK 7 S D+E + S +K F + D + K ++ Sbjct: 296 RSDLDDESKRRESHDKHFERQRSDLDDEYKRRE 328 >At2g35210.1 68415.m04319 human Rev interacting-like family protein / hRIP family protein similar to ARFGAP1 protein GI:7211442 from [Homo sapiens]; contains InterPro accession IPR001164: Human Rev interacting-like protein (hRIP) Length = 395 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -3 Query: 204 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 40 E+++ ++F N ++ SS N + ++ E KSS K S SS F DGD Sbjct: 294 ETDEARKKFTNAKSISSAQYFGNDNNSADLEAKSSLKKFSGSSAISSADLFGDGD 348 >At1g76770.1 68414.m08934 heat shock protein-related contains similarity to 17.9 kDa heat-shock protein [Helianthus annuus] gi|11990130|emb|CAB55634 Length = 244 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = -3 Query: 237 KSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 58 K+ E E+ + E EN+EAE ++ V G+ R GK EE E K Sbjct: 154 KTEEKTEPEEEIKEETKPEEENEEAEEPQREEEEEVVEEGT-RDHEGKKEEEIEDKPRKK 212 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 27.1 bits (57), Expect = 8.3 Identities = 20/87 (22%), Positives = 32/87 (36%), Gaps = 2/87 (2%) Frame = -3 Query: 261 EDSKRDGSKS--GVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 E R SK G E+EK E + R EN + + + S+RKS + Sbjct: 779 ERPHRTNSKEDRGKRKEKEKEEERSRHRRAENSSKDKRRRSPTSNESSDDSKRKSRSRRR 838 Query: 87 EYSEQNSSNKSFNDGDASADYQTKSKK 7 S ++ +S + SK+ Sbjct: 839 SVSPSPVRSRRKRSSPSSDESSDDSKR 865 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 27.1 bits (57), Expect = 8.3 Identities = 20/87 (22%), Positives = 32/87 (36%), Gaps = 2/87 (2%) Frame = -3 Query: 261 EDSKRDGSKS--GVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 88 E R SK G E+EK E + R EN + + + S+RKS + Sbjct: 749 ERPHRTNSKEDRGKRKEKEKEEERSRHRRAENSSKDKRRRSPTSNESSDDSKRKSRSRRR 808 Query: 87 EYSEQNSSNKSFNDGDASADYQTKSKK 7 S ++ +S + SK+ Sbjct: 809 SVSPSPVRSRRKRSSPSSDESSDDSKR 835 >At1g63420.1 68414.m07172 expressed protein Length = 578 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -3 Query: 201 SNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 64 S KKS E + S++ ++NRS S S SG ++ +E N S Sbjct: 125 SEKKSPEETGSSVDCSSFLNQNRS-GSCSRTLQSGYNQNQTESNRS 169 >At1g27650.1 68414.m03379 U2 snRNP auxiliary factor small subunit, putative Strong similarity to gb|Y18349 U2 snRNP auxiliary factor, small subunit from Oryza sativa. ESTs gb|AA586295 and gb|AA597332 come from this gene Length = 296 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = -3 Query: 267 RNEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS-VNSGSERKSSGKD 91 R S R GS+S + R S NK+ + + ++RD++R GS ++SS + Sbjct: 187 RYRRSYRRGSRSR-SRSRSISPRNKRDNDRRDPSHREFSHRDRDREFYRHGSGKRSSERS 245 Query: 90 EEYSEQNSSNK 58 E S + Sbjct: 246 ERQERDGSRGR 256 >At1g22882.1 68414.m02857 expressed protein Length = 660 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = -3 Query: 213 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 55 +KSE N + + + + + +++ +G+ + D E+ EQN NK+ Sbjct: 154 KKSEINNTGTWNDTEGKDDNNFLKQSQLNKTGTGNDTESSDNEFLEQNQMNKT 206 >At1g15940.1 68414.m01913 expressed protein similar To androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens] Length = 990 Score = 27.1 bits (57), Expect = 8.3 Identities = 20/88 (22%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS-VNSGSERKSS-GKD 91 N DG K+G + ++EK+++ + AE+ + + V+S +++K+S G Sbjct: 457 NVKKHEDGIKTGKSSKKEKADNGLAKTSAKKPLAETMMVKPSGKKLVHSDAKKKNSEGAS 516 Query: 90 EEYSEQNSSNKSFNDGDASADYQTKSKK 7 + SS D A+ KS++ Sbjct: 517 MDTPIPQSSKSKKKDSRATTPATKKSEQ 544 >At1g05490.1 68414.m00559 C protein immunoglobulin-A-binding beta antigen-related contains weak similarity to C protein immunoglobulin-A-binding beta antigen [Streptococcus agalactiae] gi|18028989|gb|AAL56250 Length = 731 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 264 NEDSKRDGSKSGVTVEREKSESNKKSREFENKEAESST 151 N+DS+ + +K VTVE SE S + + SS+ Sbjct: 261 NQDSEDNNTKDNVTVESLSSEDPSSSSSSSSSSSSSSS 298 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,749,973 Number of Sequences: 28952 Number of extensions: 128324 Number of successful extensions: 1196 Number of sequences better than 10.0: 123 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1169 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -