BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0518.Seq (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 24 1.3 AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor prot... 22 5.3 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.8 bits (49), Expect = 1.3 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Frame = +2 Query: 491 LHETGLAVSRHAYKHLLXVGMIWPPP----LWMASSME 592 + E LAVS K++ + +I+PP LW+ ++E Sbjct: 446 IEEANLAVSAEREKNVSLLHLIFPPDIAKRLWLGETIE 483 >AB095514-1|BAC76336.1| 72|Apis mellifera ecdyson receptor protein. Length = 72 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -1 Query: 526 CMSANCQPRLMEPVYLCEIQCPE 458 C++ +P M P Y C ++ E Sbjct: 44 CLTVGMRPECMVPEYQCAVKRKE 66 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,802 Number of Sequences: 438 Number of extensions: 2994 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -