BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0515.Seq (449 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 30 0.19 SPBC18H10.20c |||conserved fungal protein|Schizosaccharomyces po... 24 9.4 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 24 9.4 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 29.9 bits (64), Expect = 0.19 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 Query: 119 PAVAALMDTVPTVVMEVYHPPAVPVTLIQTQTARDP 226 PAV+A + T P VV V HP P I T +DP Sbjct: 1293 PAVSASISTPPAVVPTVQHPQ--PTKQIPTAAVKDP 1326 >SPBC18H10.20c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 361 Score = 24.2 bits (50), Expect = 9.4 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 248 LMVQFQQS*WKCIIHRLFQXHXIQTQTXRDP 340 L Q QS WK I +++F I T + R+P Sbjct: 253 LSTQDLQSGWKFIDNQMFLSTQINTSSLREP 283 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 24.2 bits (50), Expect = 9.4 Identities = 19/58 (32%), Positives = 23/58 (39%) Frame = +2 Query: 62 PPAVPAQLMQAQTA*DLVHPAVAALMDTVPTVVMEVYHPPAVPVTLIQTQTARDPVHP 235 PP P M A PA+A+ P V E YHPP T + + P HP Sbjct: 908 PPPPPTASMTASA------PAIAS---PPPPKVGETYHPPTASGT--RVPPVQQPSHP 954 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.317 0.131 0.381 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,324,204 Number of Sequences: 5004 Number of extensions: 20930 Number of successful extensions: 45 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -