BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0512.Seq (489 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 27 0.091 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 4.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.0 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 27.1 bits (57), Expect = 0.091 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -3 Query: 256 CTHLMRRLRHSQVRGISIKLQEEERERRDNYVPEVSALEHDIIEV 122 CT L + + IK+ E+ E RD+++ L +D +E+ Sbjct: 157 CTKLCKEANKTAFLWYHIKIDREDEEARDDFIKLGIKLSNDKLEI 201 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/40 (22%), Positives = 22/40 (55%) Frame = -3 Query: 208 SIKLQEEERERRDNYVPEVSALEHDIIEVDPDTKDMLKML 89 ++K +E++ ++ + + D+I+V+P+ D K L Sbjct: 265 AVKRKEKKAQKEKDKPNSTTNGSPDVIKVEPELSDSEKTL 304 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 265 CWICTHLMRRLRHSQVRGISIKLQEEERE 179 C ICT+ + Q+R I L++ R+ Sbjct: 1087 CMICTYKADNKENEQLRKIQESLRDLNRK 1115 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 265 CWICTHLMRRLRHSQVRGISIKLQEEERE 179 C ICT+ + Q+R I L++ R+ Sbjct: 1087 CMICTYKADNKENEQLRKIQESLRDLNRK 1115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,203 Number of Sequences: 336 Number of extensions: 1795 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -