BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0510.Seq (429 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61350.1 68418.m07698 protein kinase family protein contains ... 27 5.4 At1g01230.1 68414.m00038 ORMDL family protein contains Pfam doma... 26 9.4 >At5g61350.1 68418.m07698 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 842 Score = 27.1 bits (57), Expect = 5.4 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = +2 Query: 80 WKYYLITTARHNLQSHLTQIRHPW------AFSVTNEPYTILHD 193 + +Y+ RH ++ H + HP FSVT + +LHD Sbjct: 100 YSFYISRPGRHWIRLHFYPLNHPLYNLTNSVFSVTTDTTVLLHD 143 >At1g01230.1 68414.m00038 ORMDL family protein contains Pfam domain PF04061: ORMDL family Length = 157 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 92 LITTARHNLQSHLTQIRHPWAF 157 L+ + + SH T RHPW F Sbjct: 107 LVPVVLYLIASHTTDYRHPWLF 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,151,675 Number of Sequences: 28952 Number of extensions: 113585 Number of successful extensions: 180 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -