BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0508.Seq (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49661| Best HMM Match : DNA_pol_B_exo (HMM E-Value=0) 31 0.70 SB_11888| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.70 SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) 28 3.7 SB_30449| Best HMM Match : DUF566 (HMM E-Value=1.2) 28 4.9 SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 >SB_49661| Best HMM Match : DNA_pol_B_exo (HMM E-Value=0) Length = 852 Score = 30.7 bits (66), Expect = 0.70 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 142 GFPSDMWPSIQIPTIPPFDPKIPNFAF 222 G PSD WP P +PPF+P N F Sbjct: 54 GRPSDKWPR---PALPPFEPASDNIQF 77 >SB_11888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 30.7 bits (66), Expect = 0.70 Identities = 21/52 (40%), Positives = 24/52 (46%) Frame = +2 Query: 62 RSRSFFLCCH*SPSRALALFGRTITFRDSQAICGPLYRSQRFRHSIPKFRTL 217 R F LCC PSRAL + R I RD Q Y +RH P+F L Sbjct: 701 RPNYFGLCCQKGPSRALGMLSREI--RDDQVSASSSY---DYRHG-PRFGRL 746 >SB_53051| Best HMM Match : rve (HMM E-Value=1.3e-14) Length = 1624 Score = 28.3 bits (60), Expect = 3.7 Identities = 21/54 (38%), Positives = 26/54 (48%) Frame = +2 Query: 59 WRSRSFFLCCH*SPSRALALFGRTITFRDSQAICGPLYRSQRFRHSIPKFRTLL 220 WR R F C P GR + RD++A C P S R RH+ P+ TLL Sbjct: 1182 WRKRHFVSCSSRWPR------GRA-SRRDARA-CAPTMPSARLRHTQPRKPTLL 1227 >SB_30449| Best HMM Match : DUF566 (HMM E-Value=1.2) Length = 415 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 133 NFPGFPSDMWPSIQ-IPTIPPFDPKIPNFAFSFPSPDNIKKTNHNPDKPXAA 285 N G PSD + Q IPT P P +PN+ S S + H P+ +A Sbjct: 341 NTIGIPSDPESNPQSIPTEGPSKPVVPNYDSSLFSEFAARLVPHEPETAYSA 392 >SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1894 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 133 NFPGFPSDMWPSIQ-IPTIPPFDPKIPNFAFSFPSPDNIKKTNHNPDKPXAA 285 N G PSD + Q IPT P P +PN+ S S + H P+ +A Sbjct: 986 NTIGIPSDPESNPQSIPTEGPSKPVVPNYDSSLFSEFAARLVPHEPETAYSA 1037 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,971,905 Number of Sequences: 59808 Number of extensions: 304667 Number of successful extensions: 671 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -