BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0508.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 25 0.33 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 24 0.77 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 9.4 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 25.4 bits (53), Expect = 0.33 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 86 CH*SPSRALALFGRTITFRDSQAICGPLYRSQRFR 190 C SPS + RDS ICG RSQ FR Sbjct: 331 CRCSPSNPSITRTGLSSVRDSSIICGGNKRSQVFR 365 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 24.2 bits (50), Expect = 0.77 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 155 SLGNPGKLSSCQTKPALA 102 S NPG + +C T PA A Sbjct: 20 SSANPGTIQACTTSPATA 37 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 Query: 54 DNGVHEVSFYVVINHHRERWL 116 DN VH +S Y +I WL Sbjct: 23 DNSVHILSKYQLITSTTLNWL 43 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,592 Number of Sequences: 438 Number of extensions: 3024 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -