BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0507.Seq (399 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 42 0.006 UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 38 0.072 UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 1.6 UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein;... 32 3.6 UniRef50_A2G1J8 Cluster: Cyclin, N-terminal domain containing pr... 32 4.8 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 41.5 bits (93), Expect = 0.006 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = +3 Query: 75 GKCFR*CSSCDDPXISPLTSQYECPQ 152 GKCFR C S ++ ISPLTS+Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 >UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Nematostella vectensis Length = 79 Score = 37.9 bits (84), Expect = 0.072 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 66 FHQSRTKVRGSKAIRYRPSSN 4 F RTKVRGSK IRYRPSSN Sbjct: 6 FRCQRTKVRGSKTIRYRPSSN 26 >UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 72 Score = 33.5 bits (73), Expect = 1.6 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -1 Query: 66 FHQSRTKVRGSKAIRYRPSSN 4 FH RTKV GSK IRY PS N Sbjct: 6 FHCQRTKVGGSKMIRYHPSLN 26 >UniRef50_UPI0000F1F069 Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 389 Score = 32.3 bits (70), Expect = 3.6 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +2 Query: 86 SLMFVLRRSXNFTSNVAIRMPPVIPINHYLG 178 S+M V+ RS FT IR+PP+ I+H+LG Sbjct: 20 SVMGVVERSAVFTRQRDIRLPPIPGISHHLG 50 >UniRef50_A2G1J8 Cluster: Cyclin, N-terminal domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Cyclin, N-terminal domain containing protein - Trichomonas vaginalis G3 Length = 169 Score = 31.9 bits (69), Expect = 4.8 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 146 PPVIPINHYLGVLKTNKXXPRSYSII 223 PP IPI YLG L TN PRS I+ Sbjct: 45 PPKIPILKYLGYLHTNGNCPRSVFIV 70 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 320,310,503 Number of Sequences: 1657284 Number of extensions: 4955302 Number of successful extensions: 9100 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9099 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16926675320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -