BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0507.Seq (399 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0148 - 1337494-1338057 27 5.5 04_01_0178 + 2006369-2006494,2006582-2006664,2007693-2007819,200... 26 9.5 >01_01_0148 - 1337494-1338057 Length = 187 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 60 DENTFGKCFR*CSSCDDPXISP 125 DE G+CFR C +C DP P Sbjct: 72 DELEPGQCFRQCEACRDPPGRP 93 >04_01_0178 + 2006369-2006494,2006582-2006664,2007693-2007819, 2008579-2008638,2009606-2009735,2009821-2010047, 2010226-2010318,2010395-2010466,2011392-2011532, 2012045-2012047,2012387-2012443,2012909-2012995, 2013081-2013116 Length = 413 Score = 26.2 bits (55), Expect = 9.5 Identities = 18/59 (30%), Positives = 24/59 (40%) Frame = +2 Query: 137 IRMPPVIPINHYLGVLKTNKXXPRSYSIIPCTKYSXSIFTRFEHSNLFKVKLSAHLDTH 313 I+M P P H+L N + P YS +I F H+N F + L TH Sbjct: 53 IKMVPPGP--HFLYYCSPNSYGQNNLHEKPHIDYSSTICDPFRHANEFAPTVGFFLTTH 109 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,555,641 Number of Sequences: 37544 Number of extensions: 131538 Number of successful extensions: 237 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 237 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -