BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0507.Seq (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10890.1 68417.m01772 expressed protein 27 3.5 At2g36350.1 68415.m04461 protein kinase, putative similar to pro... 27 6.1 >At4g10890.1 68417.m01772 expressed protein Length = 527 Score = 27.5 bits (58), Expect = 3.5 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 105 RKTNISESICQRCFHQS-RTKVRGSKAIRYRPSSN 4 ++T I +C RC+H S R K+R S R S++ Sbjct: 194 KQTKICSRVCSRCYHYSMRQKLRHSLHTRILKSNS 228 >At2g36350.1 68415.m04461 protein kinase, putative similar to protein kinase KIPK (KCBP-interacting protein kinase) [Arabidopsis thaliana] gi|7716430|gb|AAF68383 Length = 949 Score = 26.6 bits (56), Expect = 6.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 255 PALSTLICSK*NCRPTSTLTEXH 323 P+ S L+C K +C ST TE H Sbjct: 391 PSASQLLCQKCHCAVKSTSTENH 413 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,999,884 Number of Sequences: 28952 Number of extensions: 112804 Number of successful extensions: 218 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -