BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0505.Seq (528 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 2.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 5.1 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 5.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 5.1 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 5.1 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = -1 Query: 243 YMLSHTRIEFEQPTEEQAESVVAEP 169 + L + + E+E P+EE + ++ +P Sbjct: 320 HRLVYFQNEYEHPSEEDVKRIINQP 344 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 5.1 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -3 Query: 334 KLKGPDS*QSFLRKTSTASIRSMTINQIYILHVEPY 227 K GPDS SF+ + + S + H PY Sbjct: 363 KSLGPDSVYSFINNLTDRKLLSAWYMNTVLGHQNPY 398 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 5.1 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = -3 Query: 334 KLKGPDS*QSFLRKTSTASIRSMTINQIYILHVEPY 227 K GPDS SF+ + + S + H PY Sbjct: 255 KSLGPDSVYSFINNLTDRKLLSAWYMNTVLGHQNPY 290 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 5.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 191 ACSSVGCSNSI 223 ACSS GCS + Sbjct: 349 ACSSAGCSQKV 359 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 5.1 Identities = 7/33 (21%), Positives = 14/33 (42%) Frame = -1 Query: 207 PTEEQAESVVAEPDFIFNKPYFFMTLNQYNTPG 109 P + + ++ P ++N P Y+ PG Sbjct: 269 PMQRPKSASLSPPPHVYNPPDHIQQATPYSAPG 301 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,274 Number of Sequences: 336 Number of extensions: 1920 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -