BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0505.Seq (528 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0131 - 1013982-1016246 28 4.0 10_08_0684 - 19870715-19872994 27 9.3 >03_01_0131 - 1013982-1016246 Length = 754 Score = 28.3 bits (60), Expect = 4.0 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -1 Query: 249 ISYMLSHTRIEFE-QPTEEQAESVVAEPDFIFNKPYFFMTLNQYNTPGFVGL 97 I Y SH F Q T+++AE++ + I P F+ L ++PGF+GL Sbjct: 72 IIYSYSHVLSGFAAQLTDDEAEAMRKKEGCIRLYPEEFLPLATTHSPGFLGL 123 >10_08_0684 - 19870715-19872994 Length = 759 Score = 27.1 bits (57), Expect = 9.3 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -1 Query: 204 TEEQAESVVAEPDFIFNKPYFFMTLNQYNTPGFVGL 97 T+E+AE+V A + P F+ L +PGF+GL Sbjct: 95 TDEEAEAVRATAGCLRLYPEEFLPLATTRSPGFLGL 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,535,597 Number of Sequences: 37544 Number of extensions: 189315 Number of successful extensions: 355 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 355 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1166441080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -