BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0505.Seq (528 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g67360.1 68418.m08494 cucumisin-like serine protease (ARA12) ... 28 3.4 At1g29150.1 68414.m03567 26S proteasome regulatory subunit, puta... 27 7.8 >At5g67360.1 68418.m08494 cucumisin-like serine protease (ARA12) Asp48; almost identical to cucumisin-like serine protease (ARA12) GI:3176874 from [Arabidopsis thaliana] Length = 757 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -1 Query: 204 TEEQAESVVAEPDFIFNKPYFFMTLNQYNTPGFVGLITH 88 T+E+A+S++ +P I P L+ TP F+GL H Sbjct: 81 TQEEADSLMTQPGVISVLPEHRYELHTTRTPLFLGLDEH 119 >At1g29150.1 68414.m03567 26S proteasome regulatory subunit, putative (RPN6) similar to 19S proteosome subunit 9 GB:AAC34120 GI:3450889 from [Arabidopsis thaliana] Length = 419 Score = 27.1 bits (57), Expect = 7.8 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = -1 Query: 507 SVVLGTSLNDNEDLSVAFNELRDPATXPYILTQTESXYLKLCSSDRIDIER 355 ++ L N +E +++ + L DP++ P + E LC DR+ E+ Sbjct: 10 TISLALEANSSEAITILYQVLEDPSSSPEAIRIKEQAITNLC--DRLTEEK 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,609,021 Number of Sequences: 28952 Number of extensions: 165374 Number of successful extensions: 347 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 347 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 977150592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -