BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0503.Seq (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60110.1 68416.m06712 DNA-binding bromodomain-containing prot... 43 2e-04 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 40 8e-04 At2g22795.1 68415.m02704 expressed protein 40 0.001 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 39 0.002 At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa... 39 0.003 At5g42880.1 68418.m05226 hypothetical protein contains Pfam prof... 38 0.004 At1g29470.1 68414.m03605 dehydration-responsive protein-related ... 38 0.004 At5g53800.1 68418.m06685 expressed protein 38 0.006 At3g28770.1 68416.m03591 expressed protein 37 0.010 At5g53930.1 68418.m06710 expressed protein 36 0.013 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 36 0.018 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 36 0.024 At4g31880.1 68417.m04531 expressed protein 36 0.024 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 36 0.024 At2g27470.1 68415.m03320 CCAAT-box binding transcription factor ... 36 0.024 At1g03080.1 68414.m00282 kinase interacting family protein simil... 36 0.024 At5g41020.1 68418.m04986 myb family transcription factor contain... 35 0.031 At5g24290.2 68418.m02858 integral membrane family protein contai... 35 0.031 At5g24290.1 68418.m02857 integral membrane family protein contai... 35 0.031 At3g29075.1 68416.m03637 glycine-rich protein 35 0.031 At4g32610.1 68417.m04643 mitochondrial glycoprotein family prote... 35 0.041 At2g19870.1 68415.m02323 tRNA/rRNA methyltransferase (SpoU) fami... 35 0.041 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 35 0.041 At1g13220.1 68414.m01533 nuclear matrix constituent protein-rela... 35 0.041 At4g39190.1 68417.m05549 expressed protein ; expression support... 34 0.054 At3g59800.1 68416.m06673 expressed protein 34 0.054 At5g16500.1 68418.m01928 protein kinase family protein contains ... 34 0.072 At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim... 34 0.072 At1g29950.2 68414.m03661 expressed protein 34 0.072 At1g29950.1 68414.m03660 expressed protein 34 0.072 At4g26630.1 68417.m03837 expressed protein 33 0.095 At5g60530.1 68418.m07590 late embryogenesis abundant protein-rel... 33 0.13 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 33 0.13 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 33 0.13 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 33 0.13 At4g30480.2 68417.m04328 tetratricopeptide repeat (TPR)-containi... 33 0.13 At4g30480.1 68417.m04327 tetratricopeptide repeat (TPR)-containi... 33 0.13 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 33 0.13 At1g56660.1 68414.m06516 expressed protein 33 0.13 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 33 0.17 At1g07980.1 68414.m00869 histone-like transcription factor (CBF/... 33 0.17 At5g60030.1 68418.m07527 expressed protein 32 0.22 At4g26190.1 68417.m03770 expressed protein 32 0.22 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 32 0.22 At5g61330.1 68418.m07696 rRNA processing protein-related contain... 32 0.29 At4g15030.1 68417.m02309 expressed protein 32 0.29 At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyc... 32 0.29 At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyc... 32 0.29 At1g03530.1 68414.m00334 expressed protein similar to hypothetic... 32 0.29 At5g16680.1 68418.m01951 PHD finger family protein contains Pfam... 31 0.38 At4g17150.1 68417.m02581 expressed protein 31 0.38 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 31 0.38 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 31 0.38 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 31 0.38 At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00... 31 0.38 At5g61150.2 68418.m07672 leo1-like family protein weak similarit... 31 0.51 At5g61150.1 68418.m07671 leo1-like family protein weak similarit... 31 0.51 At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-co... 31 0.51 At1g76820.1 68414.m08939 expressed protein 31 0.51 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 31 0.51 At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr... 31 0.51 At1g08760.1 68414.m00975 expressed protein similar to At1g21030,... 31 0.51 At5g64030.1 68418.m08039 dehydration-responsive protein-related ... 31 0.67 At5g60800.1 68418.m07628 heavy-metal-associated domain-containin... 31 0.67 At5g47690.1 68418.m05887 expressed protein 31 0.67 At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E... 31 0.67 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 31 0.67 At3g58840.1 68416.m06558 expressed protein 31 0.67 At3g52220.1 68416.m05737 expressed protein 31 0.67 At3g05060.1 68416.m00549 SAR DNA-binding protein, putative stron... 31 0.67 At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50... 31 0.67 At1g35660.1 68414.m04432 expressed protein 31 0.67 At1g32810.1 68414.m04044 expressed protein 31 0.67 At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR016... 31 0.67 At5g64910.1 68418.m08165 expressed protein ; expression support... 30 0.89 At5g37010.1 68418.m04438 expressed protein 30 0.89 At4g35080.2 68417.m04981 high-affinity nickel-transport family p... 30 0.89 At4g35080.1 68417.m04980 high-affinity nickel-transport family p... 30 0.89 At2g34300.1 68415.m04196 dehydration-responsive protein-related ... 30 0.89 At5g56360.1 68418.m07034 calmodulin-binding protein similar to a... 30 1.2 At5g25790.1 68418.m03061 tesmin/TSO1-like CXC domain-containing ... 30 1.2 At5g19310.1 68418.m02301 homeotic gene regulator, putative simil... 30 1.2 At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein ... 30 1.2 At3g09710.1 68416.m01150 calmodulin-binding family protein low s... 30 1.2 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 29 1.5 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 29 1.5 At2g28910.1 68415.m03513 CAX-interacting protein 4 (CAXIP4) cont... 29 1.5 At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein ... 29 1.5 At2g17970.1 68415.m02084 oxidoreductase, 2OG-Fe(II) oxygenase fa... 29 1.5 At1g21630.1 68414.m02708 calcium-binding EF hand family protein ... 29 1.5 At5g64810.1 68418.m08150 WRKY family transcription factor contai... 29 2.0 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 29 2.0 At5g12230.1 68418.m01435 expressed protein 29 2.0 At5g05240.1 68418.m00560 expressed protein similar to unknown pr... 29 2.0 At3g57300.1 68416.m06378 transcriptional activator, putative sim... 29 2.0 At3g48120.1 68416.m05248 expressed protein 29 2.0 At5g53440.1 68418.m06641 expressed protein 29 2.7 At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)... 29 2.7 At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)... 29 2.7 At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative... 29 2.7 At4g35940.1 68417.m05113 expressed protein 29 2.7 At4g00480.1 68417.m00066 myc-related transcription factor (MYC1)... 29 2.7 At3g25840.1 68416.m03219 protein kinase family protein contains ... 29 2.7 At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing prote... 29 2.7 At2g33480.1 68415.m04104 no apical meristem (NAM) family protein... 29 2.7 At1g79200.1 68414.m09234 expressed protein 29 2.7 At1g73960.1 68414.m08565 expressed protein similar to TATA bindi... 29 2.7 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 29 2.7 At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family ... 29 2.7 At1g21390.1 68414.m02676 expressed protein 29 2.7 At1g15940.1 68414.m01913 expressed protein similar To androgen-i... 29 2.7 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 28 3.6 At5g27860.1 68418.m03342 expressed protein 28 3.6 At5g27120.1 68418.m03237 SAR DNA-binding protein, putative stron... 28 3.6 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 28 3.6 At1g70505.1 68414.m08114 expressed protein 28 3.6 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 28 3.6 At1g01440.1 68414.m00059 extra-large G-protein-related weak simi... 28 3.6 At5g50840.2 68418.m06299 expressed protein 28 4.7 At5g50840.1 68418.m06298 expressed protein 28 4.7 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 28 4.7 At5g43130.1 68418.m05265 transcription initiation factor IID (TF... 28 4.7 At4g29940.1 68417.m04259 pathogenesis-related homeodomain protei... 28 4.7 At2g28150.1 68415.m03419 expressed protein 28 4.7 At2g27170.1 68415.m06029 structural maintenance of chromosomes (... 28 4.7 At1g74830.1 68414.m08670 expressed protein contains Pfam profile... 28 4.7 At5g62750.1 68418.m07877 expressed protein predicted proteins, C... 27 6.2 At5g55300.1 68418.m06891 DNA topoisomerase I identical to Swiss-... 27 6.2 At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp... 27 6.2 At5g05050.1 68418.m00536 peptidase C1A papain family protein wea... 27 6.2 At4g40020.1 68417.m05666 hypothetical protein 27 6.2 At3g58050.1 68416.m06471 expressed protein 27 6.2 At3g23540.1 68416.m02962 expressed protein ; expression supporte... 27 6.2 At3g18810.1 68416.m02389 protein kinase family protein contains ... 27 6.2 At2g32250.2 68415.m03942 far-red impaired responsive protein, pu... 27 6.2 At2g32250.1 68415.m03941 far-red impaired responsive protein, pu... 27 6.2 At1g69280.1 68414.m07943 expressed protein 27 6.2 At1g61040.1 68414.m06872 plus-3 domain-containing protein contai... 27 6.2 At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calr... 27 6.2 At1g55460.1 68414.m06343 Kin17 DNA-binding protein-related conta... 27 6.2 At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) fa... 27 6.2 At1g29000.1 68414.m03546 heavy-metal-associated domain-containin... 27 6.2 At1g16220.1 68414.m01942 protein phosphatase 2C family protein /... 27 6.2 At1g05910.1 68414.m00620 cell division cycle protein 48-related ... 27 6.2 At5g66950.1 68418.m08440 expressed protein 27 8.3 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 27 8.3 At5g63550.1 68418.m07976 expressed protein 27 8.3 At5g58880.1 68418.m07377 hypothetical protein 27 8.3 At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative 27 8.3 At5g51410.2 68418.m06374 LUC7 N_terminus domain-containing prote... 27 8.3 At5g51410.1 68418.m06373 LUC7 N_terminus domain-containing prote... 27 8.3 At5g44690.1 68418.m05476 hypothetical protein 27 8.3 At4g09890.1 68417.m01620 expressed protein 27 8.3 At3g61380.1 68416.m06869 expressed protein 27 8.3 At3g45400.1 68416.m04901 exostosin family protein contains Pfam ... 27 8.3 At3g20550.1 68416.m02601 forkhead-associated domain-containing p... 27 8.3 At3g12010.1 68416.m01488 expressed protein contains Prosite PS00... 27 8.3 At3g11590.1 68416.m01416 expressed protein 27 8.3 At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative simila... 27 8.3 At3g09450.1 68416.m01123 hypothetical protein 27 8.3 At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family pr... 27 8.3 At2g35210.1 68415.m04319 human Rev interacting-like family prote... 27 8.3 At2g31030.1 68415.m03783 oxysterol-binding family protein simila... 27 8.3 At1g76770.1 68414.m08934 heat shock protein-related contains sim... 27 8.3 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 27 8.3 At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1)... 27 8.3 At1g63420.1 68414.m07172 expressed protein 27 8.3 At1g22882.1 68414.m02857 expressed protein 27 8.3 >At3g60110.1 68416.m06712 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 438 Score = 42.7 bits (96), Expect = 2e-04 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 3/125 (2%) Frame = -2 Query: 490 SSETKTGK-RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 + +TKTG+ ++ K + E S+ + +E EN + E T DK +SV +R Sbjct: 281 AKDTKTGRAKNNIKKQTDTKTESSDDDDDEKE-ENSKTEKKTVADKKKSVADFLKRIKKN 339 Query: 313 KDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERT--KLLS 140 ++ E S N+ NDG+ + K N + K+ +K++ K+ L T K + Sbjct: 340 SPQKGKETTSKNQKKNDGNVK---KENDHQ-KKSDGNVKKENSKVKPRELRSSTGKKKVE 395 Query: 139 AKKNN 125 + NN Sbjct: 396 VENNN 400 Score = 27.9 bits (59), Expect = 4.7 Identities = 27/131 (20%), Positives = 55/131 (41%), Gaps = 6/131 (4%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSG--VTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG 335 +T T S + K + SK+ +++KS ++ R +N + KN+ N G Sbjct: 298 DTKTESSDDDDDEKEENSKTEKKTVADKKKSVADFLKRIKKNSPQKGKETTSKNQKKNDG 357 Query: 334 SERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLK----RILPEIKRKRKKLTQEI 167 + +K + ++ S+ N ++ L + ++++ KRK+ K T E+ Sbjct: 358 NVKKENDHQKK-SDGNVKKENSKVKPRELRSSTGKKKVEVENNNSKSSSKRKQTKETAEV 416 Query: 166 LTERTKLLSAK 134 T + S K Sbjct: 417 ATGKRGRESGK 427 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 40.3 bits (90), Expect = 8e-04 Identities = 28/113 (24%), Positives = 50/113 (44%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 305 E + G+RD + ++ ++SRE N+E++ RD R G ERK K+ Sbjct: 176 EREDGERDRREREKERGSRRNRERERSREVGNEESDDDVKRDLKRRRKEGGERKE--KER 233 Query: 304 EYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKL 146 E S SS + + + K E++ ++KKL +E+ R ++ Sbjct: 234 EKSVGRSSRHEDSPKRKSVEDNGEKKEKKTREEELEDEQKKLDEEVEKRRRRV 286 Score = 30.7 bits (66), Expect = 0.67 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 2/80 (2%) Frame = -2 Query: 508 ETGTNKSSETKTGKR--DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG 335 + G+ K E K+ S S +R+ E +K +E E + RDK+R Sbjct: 38 DKGSEKRREKDRRKKRVKSSDSEDDYDRDDDEEREKRKEKERERRR----RDKDRVKRRS 93 Query: 334 SERKSSGKDEEYSEQNSSNK 275 RKSS +++ E++ +K Sbjct: 94 ERRKSSDSEDDVEEEDERDK 113 Score = 29.9 bits (64), Expect = 1.2 Identities = 26/123 (21%), Positives = 51/123 (41%), Gaps = 1/123 (0%) Frame = -2 Query: 547 VTKIEKGY*R*IFETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFEN-KEAESS 371 V + E+G+ + G ++ + + +R + +RE+ E ++ RE E KE E Sbjct: 116 VNEKERGHREHERDRGKDRKRDREREERKDKEREREKDRERREREREEREKERVKERERR 175 Query: 370 TYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRK 191 D R + + S ++ E +D D K +L+R ++ E K K Sbjct: 176 EREDGERDRREREKERGSRRNRERERSREVGNEESDDD----VKRDLKRRRKEGGERKEK 231 Query: 190 RKK 182 ++ Sbjct: 232 ERE 234 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -1 Query: 263 RRCSADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRVNQ 108 R D + + ++ E+ KE+E+ + DG EREKE+ SR N+ Sbjct: 148 REREKDRERREREREEREKERVKERERRE--REDGERDRREREKERGSRRNR 197 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -1 Query: 266 RRRCSADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSR 117 R+R + K K+ E+ R+++E+E+ + R + + RE+E R Sbjct: 134 RKRDREREERKDKEREREKDRERRERER-EEREKERVKERERREREDGER 182 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 39.5 bits (88), Expect = 0.001 Identities = 20/81 (24%), Positives = 44/81 (54%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 ET T + E+ + + K +E+E+S ++++E EN++ E ++++ S E Sbjct: 562 ETETKEKEESSSQEETKEKENEKIEKEESAPQEETKEKENEKIE----KEESASQEETKE 617 Query: 328 RKSSGKDEEYSEQNSSNKSFN 266 +++ K++E S N S ++ N Sbjct: 618 KETETKEKEESSSNESQENVN 638 Score = 32.3 bits (70), Expect = 0.22 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = -2 Query: 472 GKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE--RKSSGKDEEY 299 G + KSG T E E E + EN+++ S + + N G+E R+ SG +E Sbjct: 195 GTEENEKSG-TEESEVEERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTEESE 253 Query: 298 SEQNSSNKSFNDGD 257 E+ N S + + Sbjct: 254 VEEKKDNGSSEESE 267 Score = 31.5 bits (68), Expect = 0.38 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 2/80 (2%) Frame = -2 Query: 505 TGTNKSSETKTGKRDGSK-SGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-S 332 T N+ S T+ + + K +G T E EKS + + E E KE + +K+ S S Sbjct: 174 TEENEKSGTEESEVEERKDNGGTEENEKSGTEESEVE-ERKENGGTEENEKSGSEESEVE 232 Query: 331 ERKSSGKDEEYSEQNSSNKS 272 E+K +G EE E++ + +S Sbjct: 233 EKKDNGGTEESREKSGTEES 252 Score = 31.5 bits (68), Expect = 0.38 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 3/86 (3%) Frame = -2 Query: 505 TGTNKSSETKTGKRDGSK-SGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-S 332 T N+ S T+ + + K +G T E EKS S + E + + R+K+ + S Sbjct: 196 TEENEKSGTEESEVEERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTEESEVE 255 Query: 331 ERKSSGKDEEYS-EQNSSNKSFNDGD 257 E+K +G EE E+ N+ ++ + Sbjct: 256 EKKDNGSSEESEVEEKKENRGIDESE 281 Score = 31.5 bits (68), Expect = 0.38 Identities = 23/89 (25%), Positives = 41/89 (46%), Gaps = 4/89 (4%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKS--ESNKKSREFENKEAESSTYRDK--NRSVN 341 E ++ SE + K +G G REKS E ++ + +N +E S +K NR ++ Sbjct: 222 EKSGSEESEVEEKKDNG---GTEESREKSGTEESEVEEKKDNGSSEESEVEEKKENRGID 278 Query: 340 SGSERKSSGKDEEYSEQNSSNKSFNDGDA 254 E K DE+ + + + ++ DA Sbjct: 279 ESEESKEKDIDEKANIEEARENNYKGDDA 307 Score = 29.5 bits (63), Expect = 1.5 Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 5/95 (5%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESN----KKSREFENKE-AESSTYRDKNRSV 344 ET T + E+ + + K +E+E E++ K E E KE ESS+ + Sbjct: 524 ETETKDNEESSSQEETKDKENEKIEKE--EASSQEESKENETETKEKEESSSQEETKEKE 581 Query: 343 NSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTK 239 N E++ S EE E+ + + ++ TK Sbjct: 582 NEKIEKEESAPQEETKEKENEKIEKEESASQEETK 616 Score = 28.7 bits (61), Expect = 2.7 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 2/80 (2%) Frame = -2 Query: 505 TGTNKSSETKTGKRDGSK-SGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-S 332 T N+ S T+ + + K +G T E EKS + + E E K+ + +K+ + S Sbjct: 152 TEENEKSGTEESEVEERKDNGGTEENEKSGTEESEVE-ERKDNGGTEENEKSGTEESEVE 210 Query: 331 ERKSSGKDEEYSEQNSSNKS 272 ERK +G EE +E++ S +S Sbjct: 211 ERKENGGTEE-NEKSGSEES 229 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = -1 Query: 242 QTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSS 120 ++ S++ K+ +K EKE+ ++ +T +EKE+SS Sbjct: 532 ESSSQEETKDKENEKIEKEEASSQEESKENETETKEKEESS 572 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/72 (22%), Positives = 32/72 (44%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 320 T + K K + + T E+E +E+ +K N+ E+ + + +E+K+ Sbjct: 596 TKEKENEKIEKEESASQEETKEKE-TETKEKEESSSNESQENVNTESEKKEQVEENEKKT 654 Query: 319 SGKDEEYSEQNS 284 E S++NS Sbjct: 655 DEDTSESSKENS 666 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = -1 Query: 242 QTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSS 120 + S++ K + K+KE++ ++ +T +EKE+SS Sbjct: 421 EVSSQEESKGKESETKDKEESSSQEESKDRETETKEKEESS 461 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 39.1 bits (87), Expect = 0.002 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 2/79 (2%) Frame = -2 Query: 505 TGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFE--NKEAESSTYRDKNRSVNSGS 332 TG ++ K GK + +R+KSES K+ E E KEA ST +++ R S S Sbjct: 715 TGKEENETDKHGKMKKER-----KRKKSESKKEGGEGEETQKEANESTKKERKRK-KSES 768 Query: 331 ERKSSGKDEEYSEQNSSNK 275 +++S G++E E + S K Sbjct: 769 KKQSDGEEETQKEPSESTK 787 Score = 36.3 bits (80), Expect = 0.013 Identities = 31/126 (24%), Positives = 59/126 (46%), Gaps = 5/126 (3%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVE-REKSESNKKSR-EFENKEAESSTYRDKNRSVNSGSERKS 320 K + K GK + V +E++E++K + + E K +S + ++ + E Sbjct: 696 KEKKDKKGKAKQKAEEIEVTGKEENETDKHGKMKKERKRKKSESKKEGGEGEETQKEANE 755 Query: 319 SGKDEEYSEQNSSNKSFNDGDARLTTKPN---LRRLKRILPEIKRKRKKLTQEILTERTK 149 S K E +++ S K +DG+ +P+ + KR PE K+K + + +E T + Sbjct: 756 STKKERKRKKSESKKQ-SDGEEETQKEPSESTKKERKRKNPESKKKAEAVEEE-ETRKES 813 Query: 148 LLSAKK 131 + S KK Sbjct: 814 VESTKK 819 Score = 32.3 bits (70), Expect = 0.22 Identities = 30/108 (27%), Positives = 49/108 (45%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 K SE+K + DG + ++E SES KK R+ +N E++ K +V RK S Sbjct: 764 KKSESKK-QSDGEEE---TQKEPSESTKKERKRKNPESKK-----KAEAVEEEETRKESV 814 Query: 313 KDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQE 170 + + + K + T KP ++ K+ E K K+K+ E Sbjct: 815 ESTKKERKRKKPKHDEEEVPNETEKPEKKKKKK--REGKSKKKETETE 860 >At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 3 WD-40 repeats (PF00400);similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56 (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens] Length = 1305 Score = 38.7 bits (86), Expect = 0.003 Identities = 23/88 (26%), Positives = 48/88 (54%), Gaps = 5/88 (5%) Frame = -2 Query: 487 SETKTGKR-DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG- 314 S +K+ K+ DG + + ++ +SN KS + + ++ S + + + NS S +KS G Sbjct: 1144 SNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGD 1203 Query: 313 ---KDEEYSEQNSSNKSFNDGDARLTTK 239 K ++ S+ ++++KS GD ++K Sbjct: 1204 SCSKSQKKSDGDTNSKSQKKGDGDSSSK 1231 Score = 38.7 bits (86), Expect = 0.003 Identities = 25/85 (29%), Positives = 48/85 (56%), Gaps = 7/85 (8%) Frame = -2 Query: 487 SETKTGKR-DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK---- 323 S +K+ K+ DG + + ++ +SN KS + + ++ S + + + NS S++K Sbjct: 1168 SNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGDTNSKSQKKGDGD 1227 Query: 322 SSGKDEEYSEQNSSNKSF--NDGDA 254 SS K + ++ +SS+KS NDGD+ Sbjct: 1228 SSSKSHKKNDGDSSSKSHKKNDGDS 1252 Score = 37.1 bits (82), Expect = 0.008 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 1/84 (1%) Frame = -2 Query: 487 SETKTGKR-DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 311 S +K+ K+ DG + + ++ +SN KS + + ++ S + + + NS S +KS G Sbjct: 1120 SNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGD 1179 Query: 310 DEEYSEQNSSNKSFNDGDARLTTK 239 S SS KS D +++ + K Sbjct: 1180 ----SNSKSSKKSDGDSNSKSSKK 1199 Score = 36.7 bits (81), Expect = 0.010 Identities = 24/85 (28%), Positives = 47/85 (55%), Gaps = 7/85 (8%) Frame = -2 Query: 487 SETKTGKR-DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG- 314 S +K+ K+ DG + + ++ +SN KS + + ++ S + + + S S++KS G Sbjct: 1156 SNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGD 1215 Query: 313 ---KDEEYSEQNSSNKSF--NDGDA 254 K ++ + +SS+KS NDGD+ Sbjct: 1216 TNSKSQKKGDGDSSSKSHKKNDGDS 1240 Score = 36.3 bits (80), Expect = 0.013 Identities = 21/92 (22%), Positives = 42/92 (45%), Gaps = 1/92 (1%) Frame = -2 Query: 487 SETKTGKR-DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 311 S +K+ K+ DG + + ++ +SN KS + + ++ S + + + NS S +KS G Sbjct: 1132 SNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGD 1191 Query: 310 DEEYSEQNSSNKSFNDGDARLTTKPNLRRLKR 215 S + S S + + N + K+ Sbjct: 1192 SNSKSSKKSDGDSCSKSQKKSDGDTNSKSQKK 1223 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSS 317 +KSS+ G + S + S+S+KKS N ++ + D N + S+ S+ Sbjct: 1122 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSN 1181 Query: 316 GKDEEYSEQNSSNKSF--NDGDA 254 K + S+ +S++KS +DGD+ Sbjct: 1182 SKSSKKSDGDSNSKSSKKSDGDS 1204 Score = 34.7 bits (76), Expect = 0.041 Identities = 22/86 (25%), Positives = 39/86 (45%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSS 317 +KSS+ G + S + S+S+KKS N ++ + D N + S+ S+ Sbjct: 1134 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSN 1193 Query: 316 GKDEEYSEQNSSNKSFNDGDARLTTK 239 K + S+ +S +KS D +K Sbjct: 1194 SKSSKKSDGDSCSKSQKKSDGDTNSK 1219 Score = 33.1 bits (72), Expect = 0.13 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 4/85 (4%) Frame = -2 Query: 496 NKSSETKTGKRDG-SKSGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGSERK 323 +KS K + D SKS + + S+S+KKS N ++ + D N + S+ Sbjct: 1108 SKSQSLKKNEGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGD 1167 Query: 322 SSGKDEEYSEQNSSNKSF--NDGDA 254 S+ K + S+ +S++KS +DGD+ Sbjct: 1168 SNSKSSKKSDGDSNSKSSKKSDGDS 1192 Score = 32.3 bits (70), Expect = 0.22 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGSERK 323 +N S K+ SKS + + S+S KKS N +++ D + + ++ Sbjct: 1180 SNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGDTNSKSQKKGDGDSSSKSHKKNDGD 1239 Query: 322 SSGKDEEYSEQNSSNKSFNDGDARLTTK 239 SS K + ++ +SS+KS D ++K Sbjct: 1240 SSSKSHKKNDGDSSSKSHKKSDGDSSSK 1267 >At5g42880.1 68418.m05226 hypothetical protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827) Length = 751 Score = 37.9 bits (84), Expect = 0.004 Identities = 39/124 (31%), Positives = 53/124 (42%), Gaps = 1/124 (0%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSES-NKKSREFENKEAESSTYRDKNRSVNSGSERKSS 317 K + K K K G+ E K S N K R E +E E S R N + S Sbjct: 636 KEANGKAEKARDGKLGMEQELRKWRSENGKRRTDEGREPEKSPTRSSTEGRNKENGFGQS 695 Query: 316 GKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLLSA 137 K + EQ SS+ N G + T NL PE K+K+KKL+ + + LS Sbjct: 696 -KSFAFGEQGSSSN--NTGGSTTTNNNNLT------PETKKKKKKLS--LFPKVFMFLSR 744 Query: 136 KKNN 125 KK++ Sbjct: 745 KKSH 748 >At1g29470.1 68414.m03605 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 37.9 bits (84), Expect = 0.004 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYR-DKNRSVNSGSERK 323 T +ET K D KSG EK+ES ++ +EF++K + D + S S+ Sbjct: 86 TEVVTETNEEKTDPEKSGEENSGEKTESAEERKEFDDKNGDGDRKNGDGEKDTESESDET 145 Query: 322 SSGKDEEYSEQNSSNKS 272 + + E + NKS Sbjct: 146 KQKEKTQLEESSEENKS 162 Score = 29.9 bits (64), Expect = 1.2 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 2/80 (2%) Frame = -2 Query: 472 GKRDG-SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 296 G++D S+S T ++EK++ + S E NK +S+ + +E+KS E Sbjct: 134 GEKDTESESDETKQKEKTQLEESSEE--NKSEDSNGTEENAGESEENTEKKSEENAGETE 191 Query: 295 EQNSSNKS-FNDGDARLTTK 239 E +K F GD TK Sbjct: 192 ESTEKSKDVFPAGDQAEITK 211 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 37.5 bits (83), Expect = 0.006 Identities = 25/85 (29%), Positives = 36/85 (42%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 KSS ++ +RD S S E SES + + E E+E R K + E K Sbjct: 92 KSSRSRRRRRDYSSSSSDSE---SESESEYSDSEESESEDERRRRKRKRKEREEEEKERK 148 Query: 313 KDEEYSEQNSSNKSFNDGDARLTTK 239 + ++ NKS DGD + K Sbjct: 149 RRRREKDKKKRNKSDKDGDKKRKEK 173 Score = 33.9 bits (74), Expect = 0.072 Identities = 15/53 (28%), Positives = 31/53 (58%) Frame = -1 Query: 266 RRRCSADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRVNQ 108 RRR + + ++ E+ R +K+K+K + + DG K E++K++S +V + Sbjct: 131 RRRKRKRKEREEEEKERKRRRREKDKKKRNKSDKDGDKKRKEKKKKKSEKVKK 183 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 36.7 bits (81), Expect = 0.010 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 6/84 (7%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDG-----SKSGVTVEREKSE-SNKKSREFENKEAESSTYRDKNRS 347 ET +++S+ K +D S+ + REK E KKS+ E + E +DK R Sbjct: 980 ETTKSENSKLKEENKDNKEKKESEDSASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKRE 1039 Query: 346 VNSGSERKSSGKDEEYSEQNSSNK 275 ERKS + EE + + K Sbjct: 1040 EKDSEERKSKKEKEESRDLKAKKK 1063 Score = 36.3 bits (80), Expect = 0.013 Identities = 32/139 (23%), Positives = 66/139 (47%), Gaps = 12/139 (8%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKN------RS 347 E+ + SE + K DGS +E ++ + + ++ ENKE+++ + DK+ + Sbjct: 674 ESKEDTKSEVEVKKNDGSSEKGEEGKENNKDSMEDKKLENKESQTDSKDDKSVDDKQEEA 733 Query: 346 VNSGSERKSSGKDEEYSEQNSS--NKSFNDGDARLTTK-PNLRRLKRILPEIKRKRKKLT 176 G E K E ++ S NK + R+ K N++ K+ ++++ KK + Sbjct: 734 QIYGGESKDDKSVEAKGKKKESKENKKTKTNENRVRNKEENVQGNKKESEKVEKGEKKES 793 Query: 175 QE---ILTERTKLLSAKKN 128 ++ + T+ K LS+ +N Sbjct: 794 KDAKSVETKDNKKLSSTEN 812 Score = 35.5 bits (78), Expect = 0.024 Identities = 27/109 (24%), Positives = 48/109 (44%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSS 317 +K+S K K + K V E +K E NKK E ++E+S +++N+ E + S Sbjct: 951 SKNSNMKK-KEEDKKEYVNNELKKQEDNKK----ETTKSENSKLKEENKDNKEKKESEDS 1005 Query: 316 GKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQE 170 ++ KS +A+ K + + + +RK KK +E Sbjct: 1006 ASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKEKEE 1054 Score = 33.5 bits (73), Expect = 0.095 Identities = 27/100 (27%), Positives = 41/100 (41%), Gaps = 3/100 (3%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRD--KNRSVNSG 335 E E G + S+ E+++S+ K +NK+ S+ RD K RS Sbjct: 765 ENRVRNKEENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEAKERSGEDN 824 Query: 334 SERKSSGKDEEYSEQNSSNKSFNDG-DARLTTKPNLRRLK 218 E K KD Y + K+ N G D + K + + LK Sbjct: 825 KEDKEESKD--YQSVEAKEKNENGGVDTNVGNKEDSKDLK 862 Score = 33.1 bits (72), Expect = 0.13 Identities = 29/142 (20%), Positives = 60/142 (42%), Gaps = 11/142 (7%) Frame = -2 Query: 508 ETGTNKSSET-KTGKRDGSKS---GVTVEREKSESNKKSREFENKEAESSTYRDKNRSVN 341 ET K SE K+ K++ K ++++E+ + KK E + +D + + Sbjct: 1066 ETKEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLED 1125 Query: 340 SGSERKSSGKDEEYSEQN-------SSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKK 182 S +K K+E+ Q+ S K + + + TK + K E+ +K KK Sbjct: 1126 QNSNKKKEDKNEKKKSQHVKLVKKESDKKEKKENEEKSETK-EIESSKSQKNEVDKKEKK 1184 Query: 181 LTQEILTERTKLLSAKKNNLLE 116 +++ ++ K + + L+ Sbjct: 1185 SSKDQQKKKEKEMKESEEKKLK 1206 Score = 31.1 bits (67), Expect = 0.51 Identities = 24/116 (20%), Positives = 43/116 (37%), Gaps = 1/116 (0%) Frame = -2 Query: 460 GSKSGVTVER-EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNS 284 GS V ++ EK E NK+ + + +DK + K+E+ E + Sbjct: 909 GSGESVKYKKDEKKEGNKEENKDTINTSSKQKGKDKKKKKKESKNSNMKKKEEDKKEYVN 968 Query: 283 SNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLLSAKKNNLLE 116 + + + + TTK +LK + K K++ K KK+ E Sbjct: 969 NELKKQEDNKKETTKSENSKLKEENKDNKEKKESEDSASKNREKKEYEEKKSKTKE 1024 Score = 30.3 bits (65), Expect = 0.89 Identities = 33/129 (25%), Positives = 54/129 (41%), Gaps = 4/129 (3%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSES--NKKSREFENKEAESSTYRDKNRSVNSGSERKS 320 + SETK + S+ ++EK S +K +E E KE+E + KN +RK Sbjct: 1161 EKSETKEIESSKSQKNEVDKKEKKSSKDQQKKKEKEMKESEEKKLK-KNE-----EDRKK 1214 Query: 319 SGKDEEYSEQNSSNKSFN--DGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKL 146 EE +Q + K N D + TTK + + + + E K + + T+ Sbjct: 1215 QTSVEENKKQKETKKEKNKPKDDKKNTTKQSGGKKESMESESKEAENQQKSQATTQADS- 1273 Query: 145 LSAKKNNLL 119 KN +L Sbjct: 1274 -DESKNEIL 1281 Score = 29.9 bits (64), Expect = 1.2 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 2/79 (2%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVE-REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSS 317 +S E ++ SK +VE +EK+E+ NKE D++ V + E Sbjct: 819 RSGEDNKEDKEESKDYQSVEAKEKNENGGVDTNVGNKEDSKDLKDDRSVEVKANKEESMK 878 Query: 316 GKDEEYSEQN-SSNKSFND 263 K EE + SS K D Sbjct: 879 KKREEVQRNDKSSTKEVRD 897 Score = 29.9 bits (64), Expect = 1.2 Identities = 33/114 (28%), Positives = 50/114 (43%), Gaps = 5/114 (4%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 E + ++ +T K + SK +E+++ NK E KE+E S KNR E Sbjct: 970 ELKKQEDNKKETTKSENSKL-----KEENKDNK-----EKKESEDSA--SKNREKKEYEE 1017 Query: 328 RKSSGKDEEYSEQNSS---NKSFNDGDARLT--TKPNLRRLKRILPEIKRKRKK 182 +KS K+E E+ S + D + R + K R LK E + K KK Sbjct: 1018 KKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKEKEESRDLKAKKKEEETKEKK 1071 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/78 (21%), Positives = 26/78 (33%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 E+ +K T D K E + + K ENK + + +N G+E Sbjct: 399 ESTNDKMVNATTNDEDHKKENKEETHENNGESVKGENLENKAGNEESMKGENLENKVGNE 458 Query: 328 RKSSGKDEEYSEQNSSNK 275 E N S+K Sbjct: 459 ELKGNASVEAKTNNESSK 476 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = -1 Query: 266 RRRCSADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQS 123 + R + + K K ++ + ++KK+ + D + S++EKE+S Sbjct: 1008 KNREKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKEKEES 1055 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/53 (22%), Positives = 27/53 (50%) Frame = -1 Query: 266 RRRCSADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRVNQ 108 + + S+ Q K K+ E + +KK K+ + R + + ++++KE N+ Sbjct: 1181 KEKKSSKDQQKKKEKEMKESEEKKLKKNEEDRKKQTSVEENKKQKETKKEKNK 1233 Score = 27.5 bits (58), Expect = 6.2 Identities = 20/84 (23%), Positives = 32/84 (38%), Gaps = 3/84 (3%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVE---REKSESNKKSREFENKEAESSTYRDKNRSVNS 338 E+ + SE + K GS +E R S ++ ENK + ST + + Sbjct: 352 ESKEDVKSEVEAAKNAGSSMTGKLEEAQRNNGVSTNETMNSENKGSGESTNDKMVNATTN 411 Query: 337 GSERKSSGKDEEYSEQNSSNKSFN 266 + K K+E + S K N Sbjct: 412 DEDHKKENKEETHENNGESVKGEN 435 >At5g53930.1 68418.m06710 expressed protein Length = 529 Score = 36.3 bits (80), Expect = 0.013 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 7/112 (6%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSR------EFENKEAESSTYRDKNRSVNSGS 332 KSS + +D S +V+++KS+ NK + E E+ ++SS Y Sbjct: 3 KSSSSSKIIKDSSNKLRSVKKKKSKRNKSKKIRRIKDESESSGSDSSLYSSSEDDYRRKK 62 Query: 331 ERKSSGKDEEYSEQNSSNKSFNDG-DARLTTKPNLRRLKRILPEIKRKRKKL 179 +R+S + ++ SS++S +D D RL K +R KR + +K+KK+ Sbjct: 63 KRRSKLSKKRSRKRYSSSESDDDSDDDRLLKKK--KRSKRKDENVGKKKKKV 112 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 35.9 bits (79), Expect = 0.018 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 1/90 (1%) Frame = -2 Query: 436 EREKSESNKKSR-EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 260 ER+K + KK R E + +EAE R+K S S+ K K E+ +++ + + Sbjct: 7 ERKKEKKEKKERKERKRREAEELAVREKKISKKHKSKSKEEEKPEKSKKKSKKYEEVEEE 66 Query: 259 DARLTTKPNLRRLKRILPEIKRKRKKLTQE 170 + + P+ ++ K E K+K K+ + E Sbjct: 67 EKSPSPSPSPKKSK----ESKKKHKRSSDE 92 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREKSESN-KKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 308 E K K+ SKS + EKS+ KK E E +E S +S S + K S + Sbjct: 33 EKKISKKHKSKSKEEEKPEKSKKKSKKYEEVEEEEKSPSPSPSPKKSKESKKKHKRSSDE 92 Query: 307 EE 302 E Sbjct: 93 SE 94 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 35.5 bits (78), Expect = 0.024 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSRE-FENKEAESSTYRDKNRSVNSGSERKSS 317 K + K + + ++ ++ R+K KSR+ + K+ E R K+R N K Sbjct: 62 KERDRKRSRDEDTEKEISRGRDKEREKDKSRDRVKEKDKEKERNRHKDRE-NERDNEKEK 120 Query: 316 GKDEEYSEQNSSNKSFNDGD 257 KD ++ +S KS D D Sbjct: 121 DKDRARVKERASKKSHEDDD 140 Score = 31.1 bits (67), Expect = 0.51 Identities = 28/114 (24%), Positives = 60/114 (52%), Gaps = 11/114 (9%) Frame = -2 Query: 478 KTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS-VNSGSERKSSGKDEE 302 K ++D S+ V E++K + + ++ EN E ++ +DK+R+ V + +KS D+E Sbjct: 84 KEREKDKSRDRVK-EKDKEKERNRHKDREN-ERDNEKEKDKDRARVKERASKKSHEDDDE 141 Query: 301 YSE-----QNSSNKSFNDG----DARLTTK-PNLRRLKRILPEIKRKRKKLTQE 170 + ++S N+ N+G DA + K + L+ + +++ +RKK ++ Sbjct: 142 THKAAERYEHSDNRGLNEGGDNVDAASSGKEASALDLQNRILKMREERKKKAED 195 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK-SSGKD 308 E + G+R K + ++EK +K R+ +++ + RD+ RS + +E++ S G+D Sbjct: 26 EHRDGRRK-EKDHRSKDKEKDYDREKIRDKDHRR-DKEKERDRKRSRDEDTEKEISRGRD 83 Query: 307 EEYSEQNSSNK 275 +E + S ++ Sbjct: 84 KEREKDKSRDR 94 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 236 KSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQS 123 K + +K RD+K DT + EREK++S Sbjct: 54 KDHRRDKEKERDRKRSRDEDTEKEISRGRDKEREKDKS 91 >At4g31880.1 68417.m04531 expressed protein Length = 873 Score = 35.5 bits (78), Expect = 0.024 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 8/86 (9%) Frame = -2 Query: 505 TGTNKSSETKTGKRDGSKSGVTVE---REKSESNKKSREFE-----NKEAESSTYRDKNR 350 T +KSS+T + SKS + E E++ S ++S E E K S + +D + Sbjct: 717 TPASKSSKTSQDDKTASKSKDSKEASREEEASSEEESEEEEPPKTVGKSGSSRSKKDISS 776 Query: 349 SVNSGSERKSSGKDEEYSEQNSSNKS 272 SG + SS K EE S+ +S+KS Sbjct: 777 VSKSGKSKASSKKKEEPSKATTSSKS 802 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 35.5 bits (78), Expect = 0.024 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 2/104 (1%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 + + G++ S++G R + E R+ E + + T R ++RSV ++ K Sbjct: 614 RRDSSSRGEKKSSRAGSRSPRRRKEVKSTPRDDEENKVKRRT-RSRSRSVEDSADIKDKS 672 Query: 313 KDEE--YSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKR 188 +DEE + ++ S ++S D T N K+ + R R Sbjct: 673 RDEELKHHKKRSRSRSREDRSKTRDTSRNSDEAKQKHRQRSRSR 716 Score = 29.9 bits (64), Expect = 1.2 Identities = 23/87 (26%), Positives = 35/87 (40%) Frame = -2 Query: 487 SETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 308 S++ GKR +K T R+K + R + +E RD S E+KS + Sbjct: 793 SKSVEGKRSYNKE--TRSRDKKSKRRSGRRSRSPSSEGKQGRDIRSSPGYSDEKKS--RH 848 Query: 307 EEYSEQNSSNKSFNDGDARLTTKPNLR 227 + +S S K + D R LR Sbjct: 849 KRHSRSRSIEKKNSSRDKRSKRHERLR 875 >At2g27470.1 68415.m03320 CCAAT-box binding transcription factor subunit HAP3-related contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to polymerase epsilon p17 subunit (DNA polymerase epsilon subunit 3) (YB-like protein 1) (YBL1) (NF-YB-like protein) (SP:Q9JKP7) [Mus musculus]; Length = 275 Score = 35.5 bits (78), Expect = 0.024 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 1/77 (1%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVN-SGS 332 E G ++ E + D + T E E N EN E + D+ S+ +G+ Sbjct: 172 ENGNDEEDENGNDEEDENDDENTEENGNDEENDDENTEENGNDEENEKEDEENSMEENGN 231 Query: 331 ERKSSGKDEEYSEQNSS 281 E + SG ++ E+N S Sbjct: 232 ESEESGNEDHSMEENGS 248 Score = 30.7 bits (66), Expect = 0.67 Identities = 22/84 (26%), Positives = 41/84 (48%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 E N ++E + G + ++G E E + N + EN E + D+N N G++ Sbjct: 162 EETENDNTEEENGNDEEDENGNDEEDENDDENTE----ENGNDEEND--DENTEEN-GND 214 Query: 328 RKSSGKDEEYSEQNSSNKSFNDGD 257 ++ +DEE S + + N+S G+ Sbjct: 215 EENEKEDEENSMEENGNESEESGN 238 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 3/84 (3%) Frame = -2 Query: 505 TGT-NKSSETKTGKRD--GSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG 335 +GT +K ETK K++ ++ G + E+ + E EN E D+ + Sbjct: 125 SGTASKPKETKKRKQEEPSTQKGARKSKIDEETKRNDEETENDNTEEENGNDEEDENGND 184 Query: 334 SERKSSGKDEEYSEQNSSNKSFND 263 E ++ D+E +E+N +++ +D Sbjct: 185 EEDEN---DDENTEENGNDEENDD 205 Score = 27.5 bits (58), Expect = 6.2 Identities = 22/92 (23%), Positives = 35/92 (38%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 + G KS + KR+ + T E N E EN E D+N N E Sbjct: 145 QKGARKSKIDEETKRNDEE---TENDNTEEENGNDEEDENGNDEEDENDDENTEENGNDE 201 Query: 328 RKSSGKDEEYSEQNSSNKSFNDGDARLTTKPN 233 D+E +E+N +++ D + + N Sbjct: 202 EN----DDENTEENGNDEENEKEDEENSMEEN 229 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 35.5 bits (78), Expect = 0.024 Identities = 23/90 (25%), Positives = 45/90 (50%) Frame = -2 Query: 415 NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKP 236 N+KS + E Y++ +++ +++ +Y EQ N N+ + +L + Sbjct: 1230 NEKSELSKAVEGLECRYKEA-KAIEEDRDKQVLRLRGDYDEQVKKNSHSNEANLKL--EA 1286 Query: 235 NLRRLKRILPEIKRKRKKLTQEILTERTKL 146 +L L L EIK +++ L QE+ TER ++ Sbjct: 1287 DLMNLLMELEEIKVEKENLNQELFTERNEI 1316 >At5g41020.1 68418.m04986 myb family transcription factor contains Pfam profile: PF00249 Myb DNA binding domain Length = 588 Score = 35.1 bits (77), Expect = 0.031 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 4/129 (3%) Frame = -2 Query: 508 ETGTNKSSETKTGK-RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS 332 + G K S+ K+ + + S++ V+R+K +S K+S + ESS DK + Sbjct: 111 DDGVEKKSKEKSKETKVDSEAHDGVKRKKKKSKKESGGDVIENTESSKVSDKKKGKRKRD 170 Query: 331 ERKSSGK---DEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILT 161 + + D+E +N+ K D D + K+ KRK+KK +++ T Sbjct: 171 DTDLGAEENIDKEVKRKNNKKKPSVDSDVEDINLDSTNDGKK-----KRKKKKQSEDSET 225 Query: 160 ERTKLLSAK 134 E L S K Sbjct: 226 EENGLNSTK 234 >At5g24290.2 68418.m02858 integral membrane family protein contains Pfam domain PF01988: Integral membrane protein Length = 534 Score = 35.1 bits (77), Expect = 0.031 Identities = 23/102 (22%), Positives = 42/102 (41%), Gaps = 4/102 (3%) Frame = -2 Query: 514 IFETGTNKSSETKTGKRDGS----KSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS 347 + ETG+N+ SET + + +G+ S + +++ + + E +E E + R + S Sbjct: 85 VSETGSNEESETGSNEENGNNWLESSSTNLPNVENKRQRNGEDCEIEEEEENNERSLSDS 144 Query: 346 VNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRL 221 + K G E Y N + + K NL L Sbjct: 145 EEKSNLEKLLGTQENYELGNEDEEKNERSSSDSEEKSNLENL 186 >At5g24290.1 68418.m02857 integral membrane family protein contains Pfam domain PF01988: Integral membrane protein Length = 550 Score = 35.1 bits (77), Expect = 0.031 Identities = 23/102 (22%), Positives = 42/102 (41%), Gaps = 4/102 (3%) Frame = -2 Query: 514 IFETGTNKSSETKTGKRDGS----KSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS 347 + ETG+N+ SET + + +G+ S + +++ + + E +E E + R + S Sbjct: 101 VSETGSNEESETGSNEENGNNWLESSSTNLPNVENKRQRNGEDCEIEEEEENNERSLSDS 160 Query: 346 VNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRL 221 + K G E Y N + + K NL L Sbjct: 161 EEKSNLEKLLGTQENYELGNEDEEKNERSSSDSEEKSNLENL 202 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 35.1 bits (77), Expect = 0.031 Identities = 15/64 (23%), Positives = 32/64 (50%) Frame = -2 Query: 430 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDAR 251 EKS+ +K ++ + K+ +++ D+ + + K D++Y E+ K +ND D + Sbjct: 159 EKSKKKEKEKKKDKKKDGNNSEDDEFKKKKKKEQYKEHHDDDDYDEKKKKKKDYNDDDEK 218 Query: 250 LTTK 239 K Sbjct: 219 KKKK 222 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/88 (20%), Positives = 39/88 (44%), Gaps = 3/88 (3%) Frame = -2 Query: 511 FETGTNKSSET-KTGKRDGSKSGVTVEREKSESNKKSREFE--NKEAESSTYRDKNRSVN 341 ++ G KS + K K+D K G E ++ + KK +++ + + + + K + N Sbjct: 154 YDDGDEKSKKKEKEKKKDKKKDGNNSEDDEFKKKKKKEQYKEHHDDDDYDEKKKKKKDYN 213 Query: 340 SGSERKSSGKDEEYSEQNSSNKSFNDGD 257 E+K + ++ ++ND D Sbjct: 214 DDDEKKKKKHYNDDDDEKKKKHNYNDDD 241 Score = 31.9 bits (69), Expect = 0.29 Identities = 20/81 (24%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = -2 Query: 463 DGSKSGVTVEREKSESNKK----SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 296 DG + E+EK + KK S + E K+ + ++ + E+K KD Sbjct: 156 DGDEKSKKKEKEKKKDKKKDGNNSEDDEFKKKKKKEQYKEHHDDDDYDEKKKKKKDYNDD 215 Query: 295 EQNSSNKSFNDGDARLTTKPN 233 ++ K +ND D K N Sbjct: 216 DEKKKKKHYNDDDDEKKKKHN 236 Score = 27.9 bits (59), Expect = 4.7 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 248 DXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQ 126 D KSKK EK +DKK+ D NS+ +++KEQ Sbjct: 156 DGDEKSKKKEKEKKKDKKK----DGNNSEDDEFKKKKKKEQ 192 >At4g32610.1 68417.m04643 mitochondrial glycoprotein family protein / MAM33 family protein low similarity to SP|P40513 Mitochondrial acidic protein MAM33, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF02330: Mitochondrial glycoprotein Length = 557 Score = 34.7 bits (76), Expect = 0.041 Identities = 28/123 (22%), Positives = 51/123 (41%) Frame = -2 Query: 490 SSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 311 +++ + G++D G EK E N + + EN ES + K + ++S + Sbjct: 184 ATKDENGQQDSQDKG-----EKKEVNDEGEKKENTTGESKASKKKKKKDKQKELKESQSE 238 Query: 310 DEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLLSAKK 131 + S+ S + + + + K RLK+I K+K K T K +A+K Sbjct: 239 VKSNSDAASESAEQEESSSSIDVK---ERLKKIASMKKKKSSKEVDGASTAAAKEAAARK 295 Query: 130 NNL 122 L Sbjct: 296 AKL 298 >At2g19870.1 68415.m02323 tRNA/rRNA methyltransferase (SpoU) family protein similar to SP|P25270 Ribose methyltransferase PET56 (EC 2.1.1.-) {Saccharomyces cerevisiae}; contains Pfam profile PF00588: SpoU rRNA Methylase (RNA methyltransferase, TrmH) family Length = 589 Score = 34.7 bits (76), Expect = 0.041 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 8/111 (7%) Frame = -2 Query: 502 GTNKSSETKTGKRDGSKSGVTVEREKSESN--------KKSREFENKEAESSTYRDKNRS 347 G ++ ++ G+RD S V E +K N K ++E + S++ D+ R+ Sbjct: 164 GETRNRDSFRGRRDDRISEVEEESKKGGGNSIWVANDDKPAKEQSPRVNNRSSWDDRTRN 223 Query: 346 VNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKR 194 NS S R EE +E+ + N + DGD + +P+ R I R Sbjct: 224 QNSFSARGDDRITEE-AEEETMNHAPEDGDGIVEEEPDNTRWSEIKNRFNR 273 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 34.7 bits (76), Expect = 0.041 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 5/128 (3%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 320 T KSSE K ++ +++E+ K+ +E T++ + +N E+K Sbjct: 220 TRKSSELKLRLKEVETRESVLQQERLSFTKERESYEG------TFQKQREYLNEW-EKKL 272 Query: 319 SGKDEEYSEQ----NSSNKSFNDGDARLTTK-PNLRRLKRILPEIKRKRKKLTQEILTER 155 GK+E +EQ N + N+ + +L K L R + ++ + K T+E +T+R Sbjct: 273 QGKEESITEQKRNLNQREEKVNEIEKKLKLKEKELEEWNRKV-DLSMSKSKETEEDITKR 331 Query: 154 TKLLSAKK 131 + L+ K+ Sbjct: 332 LEELTTKE 339 >At1g13220.1 68414.m01533 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 391 Score = 34.7 bits (76), Expect = 0.041 Identities = 31/128 (24%), Positives = 60/128 (46%), Gaps = 5/128 (3%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 320 T KSSE K ++ +++E+ K+ +E T++ + +N E+K Sbjct: 233 TRKSSELKLRLKEVETRESVLQQERLSFTKERESYEG------TFQKQREYLNEW-EKKL 285 Query: 319 SGKDEEYSEQ----NSSNKSFNDGDARLTTK-PNLRRLKRILPEIKRKRKKLTQEILTER 155 GK+E +EQ N + N+ + +L K L R + ++ + K T+E +T+R Sbjct: 286 QGKEESITEQKRNLNQREEKVNEIEKKLKLKEKELEEWNRKV-DLSMSKSKETEEDITKR 344 Query: 154 TKLLSAKK 131 + L+ K+ Sbjct: 345 LEELTTKE 352 >At4g39190.1 68417.m05549 expressed protein ; expression supported by MPSS Length = 277 Score = 34.3 bits (75), Expect = 0.054 Identities = 31/121 (25%), Positives = 61/121 (50%), Gaps = 7/121 (5%) Frame = -2 Query: 457 SKSGVTVEREKSESNKKSREFENKEAESST----YRDKNRSVNSGSERKSSGKD---EEY 299 +KSG+ + +E K + +E+ ESS +D+ RS SE ++ K E Sbjct: 84 AKSGILLNQEHDPKCKSNDLYEDFVLESSRRGGFSQDEMRSGEKQSEAENEAKQSITENK 143 Query: 298 SEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLLSAKKNNLL 119 +++N +S ++R+ ++ KRI+ E K K+ K E LT+++ ++ +K + + Sbjct: 144 AKENEEKQSIT--ESRVKKSVTEKKTKRIISEKKVKQSK--PEKLTKQSTSVNREKQSEV 199 Query: 118 E 116 E Sbjct: 200 E 200 >At3g59800.1 68416.m06673 expressed protein Length = 186 Score = 34.3 bits (75), Expect = 0.054 Identities = 22/78 (28%), Positives = 39/78 (50%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 E T+K + D +S + + + ++ S+ KSR+ + K+ +S + K R S SE Sbjct: 73 EADTDKLMREYRAQLDAERS-LKLSKGRNYSSDKSRK-DKKDRDSKKKKSKKRKHYSSSE 130 Query: 328 RKSSGKDEEYSEQNSSNK 275 SS ++E SS+K Sbjct: 131 SSSSSDEDESRRSRSSSK 148 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 33.9 bits (74), Expect = 0.072 Identities = 19/75 (25%), Positives = 33/75 (44%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSS 317 NKSS + + + + E+E+ ++KK +E E +S D N + E+ Sbjct: 398 NKSSSSSDSEDEEEEKEQKAEKEEESTSKKRQEQEETATDSDDESDSNSEKDQEEEQSQL 457 Query: 316 GKDEEYSEQNSSNKS 272 K E S +S + S Sbjct: 458 EKARESSSSSSDSGS 472 Score = 31.5 bits (68), Expect = 0.38 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 E K E+ + KR + T ++S+SN + + E + + S +SGSE Sbjct: 414 EQKAEKEEESTSKKRQEQEETATDSDDESDSNSEKDQEEEQSQLEKARESSSSSSDSGSE 473 Query: 328 RKS 320 R+S Sbjct: 474 RRS 476 >At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong similarity to RNA helicase RH26 [Arabidopsis thaliana] GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH26 GI:3776024 Length = 850 Score = 33.9 bits (74), Expect = 0.072 Identities = 21/72 (29%), Positives = 42/72 (58%) Frame = -2 Query: 478 KTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 299 + G R+GS++G V+ + SES+ + R N ++ SS +++V+SGS + G+++ Sbjct: 177 RLGDREGSRNG-RVQGKSSESSFRGRSDRNVDSGSSFRGRSDKNVDSGSSFR--GRNDRN 233 Query: 298 SEQNSSNKSFND 263 + SS + +D Sbjct: 234 VDSGSSFRGRSD 245 >At1g29950.2 68414.m03661 expressed protein Length = 251 Score = 33.9 bits (74), Expect = 0.072 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 2/98 (2%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAES--STYRDKNRSVNSGSERKS 320 + ++ G+ DG S E S + SR++ N AES S+Y N + N+ ++ Sbjct: 131 EENDDNEGEEDGGDS-----EEVSTARTSSRDYGNTTAESCCSSYGYNNNNNNNSRKQSL 185 Query: 319 SGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILP 206 SG S++ S NDG R K + L+RI+P Sbjct: 186 SG---------SASSSNNDGKGRKKMKKMMGVLRRIVP 214 >At1g29950.1 68414.m03660 expressed protein Length = 251 Score = 33.9 bits (74), Expect = 0.072 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 2/98 (2%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAES--STYRDKNRSVNSGSERKS 320 + ++ G+ DG S E S + SR++ N AES S+Y N + N+ ++ Sbjct: 131 EENDDNEGEEDGGDS-----EEVSTARTSSRDYGNTTAESCCSSYGYNNNNNNNSRKQSL 185 Query: 319 SGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILP 206 SG S++ S NDG R K + L+RI+P Sbjct: 186 SG---------SASSSNNDGKGRKKMKKMMGVLRRIVP 214 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 33.5 bits (73), Expect = 0.095 Identities = 21/90 (23%), Positives = 44/90 (48%), Gaps = 8/90 (8%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEA------ESSTYRDKNRSVNSG 335 NK+ E + K + +S V E+E SE + + E+K+A E++ ++ + + G Sbjct: 223 NKTKEVEAAKAEVDESKVEDEKEGSEDENDNEKVESKDAKEDEKEETNDDKEDEKEESKG 282 Query: 334 SERKSSGKDE--EYSEQNSSNKSFNDGDAR 251 S+++ G + E+N + + D + R Sbjct: 283 SKKRGKGTSSGGKVREKNKTEEVKKDAEPR 312 >At5g60530.1 68418.m07590 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 439 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 1/83 (1%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK-S 320 N + + K+D K+ ++EK + +K+ +E ++KE + +DK ERK Sbjct: 56 NGPKDKEQEKKDKEKAAKD-KKEKEKKDKEEKEKKDKERKEKEKKDKLEKEKKDKERKEK 114 Query: 319 SGKDEEYSEQNSSNKSFNDGDAR 251 K++E + +K ++ AR Sbjct: 115 ERKEKERKAKEKKDKEESEAAAR 137 Score = 31.9 bits (69), Expect = 0.29 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = -1 Query: 236 KSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRVNQ 108 + KK ++ +A+DKKEKEK D + K +EKE+ ++ + Sbjct: 63 QEKKDKEKAAKDKKEKEKKDKEEKEKKDK-ERKEKEKKDKLEK 104 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS 347 E + E K +R + +E+EK + +K +E + KE ++ +DK S Sbjct: 79 EKKDKEEKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEKERKAKEKKDKEES 132 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 248 DXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTS-EREKEQSSR 117 D + +K ++ +DK+EKEK D + K E+EK+ R Sbjct: 67 DKEKAAKDKKEKEKKDKEEKEKKDKERKEKEKKDKLEKEKKDKER 111 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -1 Query: 248 DXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQ 126 + + K K+ ++ +DK EKEK D + K ER+ ++ Sbjct: 85 EKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEKERKAKE 125 Score = 27.5 bits (58), Expect = 6.2 Identities = 24/105 (22%), Positives = 47/105 (44%), Gaps = 1/105 (0%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREF-ENKEAESSTYRDKNRSVNSGSERKSS 317 +S K +G + V V++ K ++ K + ++KE E +DK ++ E++ Sbjct: 25 QSDGGKGNGNNGKGNEVQVDKGKGDNGKSNGNGPKDKEQEK---KDKEKAAKDKKEKEKK 81 Query: 316 GKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKK 182 K EE +++ K D K + R ++ E +RK K+ Sbjct: 82 DK-EEKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEKERKAKE 125 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = -2 Query: 508 ETGTNKSSE--TKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG 335 E G +K E ++ +R + G E+ K S K R+ + SS +RD +R G Sbjct: 57 EKGRDKDRERDSEVSRRSRDRDG---EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RG 111 Query: 334 SERKSSGKDEE 302 R+ G+D++ Sbjct: 112 ERRERGGRDDD 122 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 308 ET K + G +RE+ SE +++SR+ + ++++ + RDK+R R S +D Sbjct: 47 ETSRSKDREREKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERHHRSSRHRD 105 Query: 307 EEYSEQNSSNKSFNDGD 257 + D D Sbjct: 106 HSRERGERRERGGRDDD 122 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 522 DDKYSRQEPINHQKRR--QASVMARRAASQSKGKNPNPTR 409 DD Y R +H +RR + +RR+ S+SK ++ TR Sbjct: 121 DDDYRRSRDRDHDRRRDDRGGRRSRRSRSRSKDRSERRTR 160 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = -2 Query: 508 ETGTNKSSE--TKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG 335 E G +K E ++ +R + G E+ K S K R+ + SS +RD +R G Sbjct: 57 EKGRDKDRERDSEVSRRSRDRDG---EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RG 111 Query: 334 SERKSSGKDEE 302 R+ G+D++ Sbjct: 112 ERRERGGRDDD 122 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 308 ET K + G +RE+ SE +++SR+ + ++++ + RDK+R R S +D Sbjct: 47 ETSRSKDREREKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERHHRSSRHRD 105 Query: 307 EEYSEQNSSNKSFNDGD 257 + D D Sbjct: 106 HSRERGERRERGGRDDD 122 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 522 DDKYSRQEPINHQKRR--QASVMARRAASQSKGKNPNPTR 409 DD Y R +H +RR + +RR+ S+SK ++ TR Sbjct: 121 DDDYRRSRDRDHDRRRDDRGGRRSRRSRSRSKDRSERRTR 160 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 2/71 (2%) Frame = -2 Query: 508 ETGTNKSSE--TKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG 335 E G +K E ++ +R + G E+ K S K R+ + SS +RD +R G Sbjct: 57 EKGRDKDRERDSEVSRRSRDRDG---EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RG 111 Query: 334 SERKSSGKDEE 302 R+ G+D++ Sbjct: 112 ERRERGGRDDD 122 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/77 (24%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 308 ET K + G +RE+ SE +++SR+ + ++++ + RDK+R R S +D Sbjct: 47 ETSRSKDREREKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERHHRSSRHRD 105 Query: 307 EEYSEQNSSNKSFNDGD 257 + D D Sbjct: 106 HSRERGERRERGGRDDD 122 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 522 DDKYSRQEPINHQKRR--QASVMARRAASQSKGKNPNPTR 409 DD Y R +H +RR + +RR+ S+SK ++ TR Sbjct: 121 DDDYRRSRDRDHDRRRDDRGGRRSRRSRSRSKDRSERRTR 160 >At4g30480.2 68417.m04328 tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 277 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 4/70 (5%) Frame = -2 Query: 511 FETGTNKSSETKTGKRDGSKS-GVTVEREKSESNKKSREFE---NKEAESSTYRDKNRSV 344 FET + + + G+ DG+K+ VT + E S KK + E EA +K +++ Sbjct: 43 FETASEREISDEEGEEDGTKNDAVTSQEEPQHSEKKEEQIELMSEGEAIVDDGSNKEKAL 102 Query: 343 NSGSERKSSG 314 +E K+ G Sbjct: 103 AEANEAKAEG 112 >At4g30480.1 68417.m04327 tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 208 Score = 33.1 bits (72), Expect = 0.13 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 4/70 (5%) Frame = -2 Query: 511 FETGTNKSSETKTGKRDGSKS-GVTVEREKSESNKKSREFE---NKEAESSTYRDKNRSV 344 FET + + + G+ DG+K+ VT + E S KK + E EA +K +++ Sbjct: 43 FETASEREISDEEGEEDGTKNDAVTSQEEPQHSEKKEEQIELMSEGEAIVDDGSNKEKAL 102 Query: 343 NSGSERKSSG 314 +E K+ G Sbjct: 103 AEANEAKAEG 112 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 33.1 bits (72), Expect = 0.13 Identities = 25/91 (27%), Positives = 42/91 (46%) Frame = -2 Query: 454 KSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 275 K VE+E + + ++K+ +DKNR N K S ++E S+ N S+ Sbjct: 729 KDSEQVEKEDNSDLDANLSCDSKDTIRHQIKDKNRRKN-----KRSSREEVSSDDNGSSD 783 Query: 274 SFNDGDARLTTKPNLRRLKRILPEIKRKRKK 182 S D D R K + K+ E K++R++ Sbjct: 784 S--DVDDRKEAKRRRKEEKKTRKEEKKRRRE 812 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 33.1 bits (72), Expect = 0.13 Identities = 32/131 (24%), Positives = 54/131 (41%), Gaps = 5/131 (3%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKK----SREFENKEAESSTYRDKNRSVN 341 E K + K K++ +SG + +K++ KK S+E E E E K Sbjct: 125 ELEEEKEGKKKKNKKEKDESGPEEKNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDE 184 Query: 340 SGSE-RKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEIL 164 SG+E +K K E+ +Q +KS D + + + E K+K T + + Sbjct: 185 SGTEEKKKKPKKEK--KQKEESKSNEDKKVKGKKEKGEKGDLEKEDEEKKKEHDETDQEM 242 Query: 163 TERTKLLSAKK 131 E+ + KK Sbjct: 243 KEKDSKKNKKK 253 Score = 30.7 bits (66), Expect = 0.67 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -1 Query: 242 QTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQ 126 + K+KK E++S + KK+KEK +N D K + + ++ Sbjct: 44 KVKAKKDEESSGKSKKDKEKKKGKNVDSEVKEDKDDDKK 82 Score = 28.3 bits (60), Expect = 3.6 Identities = 24/112 (21%), Positives = 50/112 (44%), Gaps = 2/112 (1%) Frame = -2 Query: 436 EREKSESNKKSREF--ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 263 E + +E KKS+ E++E + +DK ++ ++ +DEE + +S + Sbjct: 407 EEDDTEEKKKSKVEGGESEEGKKKKKKDKKKNKKKDTKEPKMTEDEEEKKDDSKDVKIEG 466 Query: 262 GDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLLSAKKNNLLE*IK 107 A+ K + K+ +I + + KL + + E+ L +K + IK Sbjct: 467 SKAKEEKKDKDVKKKKGGNDIGKLKTKLAK--IDEKIGALMEEKAEIENQIK 516 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 32.7 bits (71), Expect = 0.17 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 239 TKSKKVEKNSARDK-KEKEKTDTRNSDGTYKTSEREKEQSSRVNQ 108 +K K+ EK ++ +E+EK TRN D + +RE+E R NQ Sbjct: 97 SKGKEPEKKREEERPREREKGKTRNIDNFMEELKREQEMRERRNQ 141 Score = 28.7 bits (61), Expect = 2.7 Identities = 16/76 (21%), Positives = 33/76 (43%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 305 E K + D +S R +++S R+ +E + RD++R + +R+ + Sbjct: 856 ERKEKREDSQESSKKRHRGENKSQSPPRKSSTRERDHDLGRDRDRERHRDRDRQHDLNRD 915 Query: 304 EYSEQNSSNKSFNDGD 257 + SS+ +D D Sbjct: 916 RDRREKSSSHDRDDND 931 >At1g07980.1 68414.m00869 histone-like transcription factor (CBF/NF-Y) family protein contains Pfam profile PF00808: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to Chromatin accessibility complex protein 1 (CHRAC-1) (CHRAC-15) (HuCHRAC15) (DNA polymerase epsilon subunit p15) (SP:Q9NRG0) {Homo sapiens} Length = 206 Score = 32.7 bits (71), Expect = 0.17 Identities = 23/100 (23%), Positives = 45/100 (45%), Gaps = 1/100 (1%) Frame = -2 Query: 505 TGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSER 326 +G +K S K+ +K V + ++K E + S + E + D+ + N + Sbjct: 22 SGRSKRSSGSRTKKTSNK--VNIVKKKPEIYEISESSSSDSVEEAIRGDEAKKSNGVVSK 79 Query: 325 KSSGKDEEYSEQNSSNKSFNDGDAR-LTTKPNLRRLKRIL 209 + +GK + S N+ +DG A K + R++RI+ Sbjct: 80 RGNGKSVGIPTKTSKNREEDDGGAEDAKIKFPMNRIRRIM 119 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 32.3 bits (70), Expect = 0.22 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 5/128 (3%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 305 + K D KS ER+K +S K + E E E K+ + + K KDE Sbjct: 168 KVKEKLEDEQKSADRKERKKKKSKKNNDEDVVDEKEKLEDEQKSAEI----KEKKKNKDE 223 Query: 304 EYSEQNSSNKSFND---GDARLTTKPNLRRLKRILPEIK--RKRKKLTQEILTERTKLLS 140 + ++ K ++ G+ + K + + I+ E + +K++K +E+ +E K S Sbjct: 224 DVVDEKEKEKLEDEQRSGERKKEKKKKRKSDEEIVSEERKSKKKRKSDEEMGSEERK--S 281 Query: 139 AKKNNLLE 116 KK L E Sbjct: 282 KKKRKLKE 289 Score = 31.9 bits (69), Expect = 0.29 Identities = 27/121 (22%), Positives = 53/121 (43%), Gaps = 1/121 (0%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDK-NRSVNSGS 332 E K ++K K +E E+ ++ R+ E K+ +++ D + V Sbjct: 114 ERDEKKMKKSKDADVVDEKVNEKLEAEQRSEERRERKKEKKKKKNNKDEDVVDEKVKEKL 173 Query: 331 ERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERT 152 E + D + ++ S K+ ND D + K L ++ EIK K+K ++++ E+ Sbjct: 174 EDEQKSADRKERKKKKSKKN-NDEDV-VDEKEKLEDEQKSA-EIKEKKKNKDEDVVDEKE 230 Query: 151 K 149 K Sbjct: 231 K 231 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -1 Query: 254 SADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQS 123 SA+ + K K +++ D+KEKEK + G K +++K +S Sbjct: 211 SAEIKEKKKNKDEDVV-DEKEKEKLEDEQRSGERKKEKKKKRKS 253 >At4g26190.1 68417.m03770 expressed protein Length = 1067 Score = 32.3 bits (70), Expect = 0.22 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 13/107 (12%) Frame = -2 Query: 463 DGSKSGVTVEREKSESNKKSRE---FENK---EAESSTYRDKNRSVNSGSERKSSGKDEE 302 D ++ G + ++ K KK +E E K E E T D+ V+ + S+G +E Sbjct: 126 DDNRKGSSTKKSKRREKKKKKEDLSCEEKLLDEVEKITSEDQ---VHPPNNPLSNGMVQE 182 Query: 301 YSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEI-------KRKRKK 182 S + + + G A++ T PNL K LP+ KRKR K Sbjct: 183 RSGELTQDSCEKPGAAQICTDPNLSTCKDSLPDATNMTSSSKRKRNK 229 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 32.3 bits (70), Expect = 0.22 Identities = 19/81 (23%), Positives = 39/81 (48%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 320 T++S E + + KS REK + ++SRE +++ + RD+ R +R Sbjct: 252 TSQSEEPSRPREEREKS-----REKGKERERSRELSHEQPRERS-RDRPREDKHHRDRDQ 305 Query: 319 SGKDEEYSEQNSSNKSFNDGD 257 G+D + + +++ + GD Sbjct: 306 GGRDRDRDSRRDRDRTRDRGD 326 >At5g61330.1 68418.m07696 rRNA processing protein-related contains weak similarity to rRNA processing protein EBP2 (EBNA1-binding protein homolog) (Swiss-Prot:P36049) [Saccharomyces cerevisiae] Length = 436 Score = 31.9 bits (69), Expect = 0.29 Identities = 34/125 (27%), Positives = 51/125 (40%), Gaps = 7/125 (5%) Frame = -2 Query: 490 SSETKTGKRDGSKSGVTVEREKSESNKKSREFENKE---AESSTYRDKN-RSVNSGSERK 323 S E G+ + G T E ++ +S + E ENKE ES + D N + SG E Sbjct: 48 SMEDDEGESEEDDEGDTEEDDEGDSEEDD-EGENKEDEDGESEDFEDGNDKESESGDEGN 106 Query: 322 SSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLK---RILPEIKRKRKKLTQEILTERT 152 KD + E K + + NL+R K + + + +K L +IL R Sbjct: 107 DDNKDAQMEELEKEVKELRSQEQDIL--KNLKRDKGEDAVKGQAVKNQKALWDKILEFRF 164 Query: 151 KLLSA 137 L A Sbjct: 165 LLQKA 169 >At4g15030.1 68417.m02309 expressed protein Length = 179 Score = 31.9 bits (69), Expect = 0.29 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -2 Query: 436 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 263 E E+SESN+K ++ N+ S Y G RKS K E + +++F++ Sbjct: 114 EGERSESNEKKKQKRNRSQSHSEYDTDEEDRRKGKTRKS--KLESADREGKDDENFDE 169 >At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 387 Score = 31.9 bits (69), Expect = 0.29 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 3/101 (2%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 + + ++K ++ S V+ +RE E+ KK E K + + S +S S+ Sbjct: 182 DAAEREKGKSKKSNKNFSPGDVS-DREAKETRKK--ESNEKRIKRKRRYSSSDSYSSSSD 238 Query: 328 RKSSGKDEEYSEQNSSNKSFNDGDARL---TTKPNLRRLKR 215 S + E YS + + S +DG R TT+ RR +R Sbjct: 239 SDSDSESEAYSSSSYESSSSSDGKHRKRKSTTRHKGRRGER 279 >At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 570 Score = 31.9 bits (69), Expect = 0.29 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 3/101 (2%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 + + ++K ++ S V+ +RE E+ KK E K + + S +S S+ Sbjct: 182 DAAEREKGKSKKSNKNFSPGDVS-DREAKETRKK--ESNEKRIKRKRRYSSSDSYSSSSD 238 Query: 328 RKSSGKDEEYSEQNSSNKSFNDGDARL---TTKPNLRRLKR 215 S + E YS + + S +DG R TT+ RR +R Sbjct: 239 SDSDSESEAYSSSSYESSSSSDGKHRKRKSTTRHKGRRGER 279 >At1g03530.1 68414.m00334 expressed protein similar to hypothetical protein GB:O14360 Length = 797 Score = 31.9 bits (69), Expect = 0.29 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 2/82 (2%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSR-EFENKEAESSTYRDK-NRSVNSG 335 E+G K+ E + V++ + E + +++ E ++ E+ES T + S +S Sbjct: 204 ESGLKKTDEGLACSIEVGLEKVSLAVDDDEKSDEAKGEMDSAESESETSSSSASSSDSSS 263 Query: 334 SERKSSGKDEEYSEQNSSNKSF 269 SE + S +DE E+N + F Sbjct: 264 SEEEESDEDESDKEENKKEEKF 285 >At5g16680.1 68418.m01951 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1290 Score = 31.5 bits (68), Expect = 0.38 Identities = 20/61 (32%), Positives = 27/61 (44%) Frame = -2 Query: 439 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 260 V EK +KSR NKE + + RS E + GK + S NSS S ++ Sbjct: 218 VSSEKGNFKEKSRPGGNKERQEPSVEGSTRS----GENRKDGKSSKSSSSNSSAVSESES 273 Query: 259 D 257 D Sbjct: 274 D 274 >At4g17150.1 68417.m02581 expressed protein Length = 402 Score = 31.5 bits (68), Expect = 0.38 Identities = 20/80 (25%), Positives = 37/80 (46%) Frame = -2 Query: 406 SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLR 227 + E E+ A +K VN+ + + S ++EE E++S K +G KP Sbjct: 317 TEEDESLTAGEGDQVEKTADVNTERKPRDSSREEE--EEDSKEKKIKNGGETDAKKPRHE 374 Query: 226 RLKRILPEIKRKRKKLTQEI 167 +L+R+ KR R + + + Sbjct: 375 KLERLEAFSKRLRHYILKRV 394 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 31.5 bits (68), Expect = 0.38 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 2/87 (2%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTV-EREKSESNKKSREFENKEAESSTYRDKNRSVN-SG 335 + +K SE K ++D K TV E E+ + K +EFE ++ + RD++ G Sbjct: 127 QNNDDKISEEK--EKDNGKENQTVQESEEGQMKKVVKEFEKEQKQQ---RDEDAGTQPKG 181 Query: 334 SERKSSGKDEEYSEQNSSNKSFNDGDA 254 ++ + G+ +E + NK + D+ Sbjct: 182 TQGQEQGQGKEQPDVEQGNKQGQEQDS 208 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 31.5 bits (68), Expect = 0.38 Identities = 31/95 (32%), Positives = 45/95 (47%), Gaps = 6/95 (6%) Frame = -2 Query: 421 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTT 242 +S +K E E E S R + E+K D E SE+NS+ KS+ D +LT Sbjct: 102 QSIEKDGEVERMSTEMSELHKSKRQLMELLEQK----DAEISEKNSTIKSYLDKIVKLTD 157 Query: 241 KPNLR--RLKRILPEIKRKR---KKLTQE-ILTER 155 + + RL E+ R + +L+QE LTER Sbjct: 158 TSSEKEARLAEATAELARSQAMCSRLSQEKELTER 192 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 31.5 bits (68), Expect = 0.38 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVT---VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSER 326 +K +E G+ G+ V+ +++ K E K + E E + + + S + E Sbjct: 1459 DKITEYHRGEEKGTAENVSSTKIQQTKDELEKPRKPSEISE-NHNIHEFMDSSQSQDIEE 1517 Query: 325 KSSGKDEEYSEQNSSNKSFNDGDAR 251 K S + E+Y++QN + ND D + Sbjct: 1518 KGSDQAEKYAKQNKIQEVMNDEDKK 1542 Score = 28.3 bits (60), Expect = 3.6 Identities = 23/91 (25%), Positives = 37/91 (40%) Frame = -2 Query: 463 DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNS 284 DG K + V K+E+NK R E +E + DK + ++ G+ ++ E Sbjct: 671 DGGKGIIAVAETKAENNKSKRVQETEEQK----LDKEDTCGKHFQKLIEGEISDHGEVED 726 Query: 283 SNKSFNDGDARLTTKPNLRRLKRILPEIKRK 191 K G R + ++ R EIK K Sbjct: 727 VEK----GKKRTEAEKRIKDRAREAEEIKEK 753 >At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 592 Score = 31.5 bits (68), Expect = 0.38 Identities = 26/125 (20%), Positives = 53/125 (42%), Gaps = 2/125 (1%) Frame = -2 Query: 514 IFETGTNKSSETKTGKRDGSKSGVTVE-REKSESNKKSREFENKEAESSTYRDKNRSVNS 338 + E G + +E + + K +E +EK E ++ +E + AE + R + Sbjct: 114 LLEEGRKRLNEEVAAQLEEEKEASLIEAKEKEEREQQEKEERERIAEENLKRVEEAQRKE 173 Query: 337 GSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRI-LPEIKRKRKKLTQEILT 161 ER+ ++E Y E + + R + RLK++ L + R KL+ + + Sbjct: 174 AMERQRK-EEERYRELEELQRQKEEAMRRKKAEEEEERLKQMKLLGKNKSRPKLSFALSS 232 Query: 160 ERTKL 146 + T + Sbjct: 233 KMTTM 237 >At5g61150.2 68418.m07672 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 623 Score = 31.1 bits (67), Expect = 0.51 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = -2 Query: 436 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 257 + E SES ++ E+E +E E + R +S E + +++E E+ SN+ ++D D Sbjct: 516 QMEYSESEREESEYETEEEEEEKSPARGRGKDSEDEYEEDAEEDE-EERGKSNR-YSDED 573 >At5g61150.1 68418.m07671 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 625 Score = 31.1 bits (67), Expect = 0.51 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = -2 Query: 436 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 257 + E SES ++ E+E +E E + R +S E + +++E E+ SN+ ++D D Sbjct: 516 QMEYSESEREESEYETEEEEEEKSPARGRGKDSEDEYEEDAEEDE-EERGKSNR-YSDED 573 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -2 Query: 436 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 296 E E+ +SN+ S E E +E + +K+ SG +RK DEE S Sbjct: 560 EEERGKSNRYSDEDEEEEEVAGGRAEKDHR-GSGRKRKGIESDEEES 605 >At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 587 Score = 31.1 bits (67), Expect = 0.51 Identities = 21/80 (26%), Positives = 38/80 (47%) Frame = -2 Query: 472 GKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 293 G+ S +R K ++ K +FE KEA+ R K R N E + G D++ +E Sbjct: 25 GRNSASPEESLGKRRKRKTVKLYEDFEEKEAD----RKKKRKGNKEDEDMAEG-DDDQAE 79 Query: 292 QNSSNKSFNDGDARLTTKPN 233 + ++ ++ + D KP+ Sbjct: 80 EETNPEAEEEEDEEEEEKPD 99 >At1g76820.1 68414.m08939 expressed protein Length = 266 Score = 31.1 bits (67), Expect = 0.51 Identities = 29/107 (27%), Positives = 48/107 (44%) Frame = -2 Query: 502 GTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK 323 G +SS++KT SKS VE +S+ +KK + E D ++ + E Sbjct: 150 GDEESSQSKTSD---SKSVELVESARSKKHKKKNKSGRTLQEDD---DLDKLLAELGETP 203 Query: 322 SSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKK 182 ++GK E++ + T + RRL R+L KRKR++ Sbjct: 204 AAGKPASEEEKDQAQPE-PVAPVENTGEKEKRRLLRLLQPRKRKRRR 249 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 31.1 bits (67), Expect = 0.51 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = -2 Query: 505 TGTNKSSETKTGKRDGSKSGVTVEREKSESNK-KSREFENKEAESSTYRDKNRSVNSGSE 329 T + ++ K KRD K ER++ E K K +E KE E + K RS S+ Sbjct: 788 TSLQEKAKEKERKRDEEKVRKEKERDEKEKRKDKDKERREKEREREKEKGKERSKREESD 847 Query: 328 RKSS 317 +++ Sbjct: 848 GETA 851 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -1 Query: 230 KKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQ 126 +KV K RD+KEK K ++ + K EREKE+ Sbjct: 804 EKVRKEKERDEKEKRKD--KDKERREKEREREKEK 836 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/58 (25%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -2 Query: 436 EREKSESNKKSR-EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 266 E+E+ +K R E E E E +DK R K GK+ E++ + + Sbjct: 796 EKERKRDEEKVRKEKERDEKEKRKDKDKERREKEREREKEKGKERSKREESDGETAMD 853 >At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 384 Score = 31.1 bits (67), Expect = 0.51 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 4/87 (4%) Frame = -2 Query: 499 TNKSSETKTG-KRDGSKSGVT--VEREKSESNKKSREFENKEAESSTYRDKNRSVN-SGS 332 T K G K + K G T E EK + +K+ E ENKEAE RDK S+ S Sbjct: 164 TEAEKVNKEGEKTEAGKEGQTEIAEAEKEKEGEKA-EAENKEAE--VVRDKKESMEVDTS 220 Query: 331 ERKSSGKDEEYSEQNSSNKSFNDGDAR 251 E + E +E+ S + D + + Sbjct: 221 ELEKKAGSGEGAEEPSKVEGLKDTEMK 247 Score = 29.5 bits (63), Expect = 1.5 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Frame = -2 Query: 487 SETKTGKRDGSKSGVT----VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 320 +E +++ K GVT E+E +E K E NKE E + + ++ + +E++ Sbjct: 134 TENAEAEKEKEKEGVTEIAEAEKENNEGEKTEAEKVNKEGEKTEAGKEGQTEIAEAEKEK 193 Query: 319 SGKDEE 302 G+ E Sbjct: 194 EGEKAE 199 >At1g08760.1 68414.m00975 expressed protein similar to At1g21030, At5g44890, At2g29240, At1g08740; similar to EST gb|N96641 Length = 748 Score = 31.1 bits (67), Expect = 0.51 Identities = 29/85 (34%), Positives = 39/85 (45%), Gaps = 8/85 (9%) Frame = -2 Query: 460 GSKSGVTVEREKSESNKK--SREFENKEAESSTYRD-KNRSV-----NSGSERKSSGKDE 305 G++ V++ R+ S KK S F K A+SS D K S+ +SGS+ S Sbjct: 166 GNRLSVSISRDDSSDGKKPVSALFRAKSAKSSLSLDVKKESLGKLKTSSGSKSIPSSPTS 225 Query: 304 EYSEQNSSNKSFNDGDARLTTKPNL 230 YS NS K N + T KP L Sbjct: 226 CYSLPNSFAKFANGIKQQQTVKPKL 250 >At5g64030.1 68418.m08039 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 829 Score = 30.7 bits (66), Expect = 0.67 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -2 Query: 436 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGS-ERKSSGKDEEYSEQNSSNKSFNDG 260 + E ++N+K + E ++ E + + S + E+KS D++ S+ + NK+ N+ Sbjct: 162 DEENPDTNEKQTKPETEDNELGEDGENQKQFESDNGEKKSIDDDKKSSDDDKENKTGNED 221 Query: 259 DARLTTKPN 233 T K N Sbjct: 222 TETKTEKEN 230 >At5g60800.1 68418.m07628 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 283 Score = 30.7 bits (66), Expect = 0.67 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -1 Query: 248 DXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKE 129 + +TK KKV+ S + KKEKEK + +D K SE +K+ Sbjct: 81 EEKTK-KKVDLVSPQPKKEKEKENKNKNDEDKKKSEEKKK 119 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 30.7 bits (66), Expect = 0.67 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 4/86 (4%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSES-NKKSREFENKEAESSTYRDKNRSVNSGSERK 323 T K + + +D KS +++E EK ES NKK R + E S + +S + G K Sbjct: 1514 TPKKNLKQLHPKDTPKS-LSLEHEKVESRNKKRRSSALPKTEYSGEAGEEKSESEGKSLK 1572 Query: 322 SSGKDEEY---SEQNSSNKSFNDGDA 254 DEE E K+ + GDA Sbjct: 1573 EGEDDEEVVNKEEDLQEAKTESSGDA 1598 >At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E2; identical to gi:431265, SP:P42748 Length = 187 Score = 30.7 bits (66), Expect = 0.67 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -2 Query: 385 EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPN 233 E Y +K GSE KSS ++ E S N+ +D D + KP+ Sbjct: 136 EQRVKEYCEKYAKPGEGSEDKSSDEELSEEEYGSDNEDDDDDDVAIAGKPD 186 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 30.7 bits (66), Expect = 0.67 Identities = 33/147 (22%), Positives = 59/147 (40%), Gaps = 3/147 (2%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 305 + T K +G + VERE+ E K E KEAE + + N N+G K + E Sbjct: 96 DVSTDKENGDE---IVEREEEE--KAVEENNEKEAEGTGNEEGNEDSNNGESEKVVDESE 150 Query: 304 ---EYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLLSAK 134 E S + + ++ DA E++ + K + E ++ S Sbjct: 151 GGNEISNEEAREINYKGDDASSEVMHGTEEKSNEKVEVEGESKSNSTENVSVHED-ESGP 209 Query: 133 KNNLLE*IKVRAATLGIPRSQTNLAEK 53 KN +LE ++ +L + ++ E+ Sbjct: 210 KNEVLEGSVIKEVSLNTTENGSDDGEQ 236 Score = 30.3 bits (65), Expect = 0.89 Identities = 20/78 (25%), Positives = 38/78 (48%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 E G++ + +T SK+G E+ S+SN + E + ++ + + S SGS Sbjct: 228 ENGSDDGEQQETKSELDSKTG---EKGFSDSNGELPETNLSTSNATETTESSGSDESGSS 284 Query: 328 RKSSGKDEEYSEQNSSNK 275 KS+G + +E++ K Sbjct: 285 GKSTGYQQTKNEEDEKEK 302 Score = 29.9 bits (64), Expect = 1.2 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = -2 Query: 502 GTNKSSETKTGKRDGSKSGVTVEREKSESNKK---SREFENKEAESSTYRDKNRSVNSGS 332 G K E + +++ S S + E+ E+ +K S + EN+ E+ + S G+ Sbjct: 346 GEGKEEEPEKREKEDSSSQEESKEEEPENKEKEASSSQEENEIKETEIKEKEESSSQEGN 405 Query: 331 ERKSSGKDEEYSEQNSSNKS 272 E K + K S++ + S Sbjct: 406 ENKETEKKSSESQRKENTNS 425 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -1 Query: 239 TKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSS 120 + S++ K + KEKE + ++ + +T +EKE+SS Sbjct: 361 SSSQEESKEEEPENKEKEASSSQEENEIKETEIKEKEESS 400 >At3g58840.1 68416.m06558 expressed protein Length = 318 Score = 30.7 bits (66), Expect = 0.67 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 5/118 (4%) Frame = -2 Query: 454 KSGVTVEREKSESNKKSREFENKEA--ESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 281 K + ++++E K+ R+ E K E +K++ + S E + DE+ E Sbjct: 142 KEAEGLRKDRAEVEKRVRDLERKIGVLEVREMEEKSKKLRSEEEMREID-DEKKREIEEL 200 Query: 280 NKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTE---RTKLLSAKKNNLLE 116 K+ + L N+ LK+ + +KKLT+E L+E R K L KK+ LL+ Sbjct: 201 QKTVIVLNLELVK--NVEELKKW-----KSKKKLTEEALSETQKREKELELKKDELLK 251 >At3g52220.1 68416.m05737 expressed protein Length = 237 Score = 30.7 bits (66), Expect = 0.67 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 236 KSKKVEKNSARDKKEK-EKTDTRNSDGTYKTSEREKEQSSR 117 K +K E++ R+K+E+ EK R+SD K + +KE+ R Sbjct: 191 KREKEERHDRREKRERHEKRSARDSDDRKKHKKEKKEKKRR 231 >At3g05060.1 68416.m00549 SAR DNA-binding protein, putative strong similarity to SAR DNA-binding protein-1 [Pisum sativum] GI:3132696; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 533 Score = 30.7 bits (66), Expect = 0.67 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYR--DKNRSVNSGSER 326 T+ SE + K+D K VE EK E + S + + K+AE+ T + + +++ Sbjct: 447 TSAKSEEPSKKKDKKKKK-KVEEEKPEEEEPSEKKKKKKAEAETEAVVEVAKEEKKKNKK 505 Query: 325 KSSGKDEEYSEQNSSNK 275 K ++EE +E + K Sbjct: 506 KRKHEEEETTETPAKKK 522 >At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50) identical to DNA repair-recombination protein GI:7110148 from [Arabidopsis thaliana] Length = 1316 Score = 30.7 bits (66), Expect = 0.67 Identities = 19/73 (26%), Positives = 30/73 (41%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 KS E + +D K G++ E+ E + S EFE + ++ + V ERK+ Sbjct: 438 KSIEAQKRAKDEIKMGISKRIEEKEIERDSFEFEISTVDVKQTDEREKQVQVELERKTKQ 497 Query: 313 KDEEYSEQNSSNK 275 E E K Sbjct: 498 NSERGFESKIEQK 510 >At1g35660.1 68414.m04432 expressed protein Length = 1155 Score = 30.7 bits (66), Expect = 0.67 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 10/88 (11%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRD-KNRSVNSGSERKSS 317 KS +G S +G + R S K +R+ ++K S RD ++ VN E KS Sbjct: 732 KSDRASSGSSASSSNGSSA-RTVPHSRKHNRKLQSKNVASKVSRDVEDERVNFKVENKSR 790 Query: 316 GKDEEYS---------EQNSSNKSFNDG 260 ++E+ S EQN SN G Sbjct: 791 KEEEDTSGETKGAVRLEQNESNSKETPG 818 >At1g32810.1 68414.m04044 expressed protein Length = 654 Score = 30.7 bits (66), Expect = 0.67 Identities = 22/81 (27%), Positives = 34/81 (41%) Frame = -2 Query: 406 SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLR 227 S+ EN+ ++S+Y + + S +S SE N NK R P R Sbjct: 405 SKGEENETTKTSSYSSRKVLLPPNSTTSTSSGPCSSSELNEHNKPSPHSSPRNNGTPVHR 464 Query: 226 RLKRILPEIKRKRKKLTQEIL 164 L ++ EI K K++ E L Sbjct: 465 TLPGLINEIMNKGKRMAYEEL 485 >At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; similar to Myosin heavy chain, non-muscle (Zipper protein) (Myosin II) (SP:Q99323) {Drosophila melanogaster} similar to EST gb|T76116 Length = 1730 Score = 30.7 bits (66), Expect = 0.67 Identities = 22/113 (19%), Positives = 48/113 (42%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 320 T + E + + + S + E+E+++ + E E + + KN+ + S S Sbjct: 935 TKSTLEAALMQAERNISDIISEKEEAQGRTATAEMEQEMLQKEASIQKNKLTEAHSTINS 994 Query: 319 SGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILT 161 + +E N + S D ++ T L+++ E + +R K+ + LT Sbjct: 995 LEETLAQTESNMDSLSKQIEDDKVLTTSLKNELEKLKIEAEFERNKMAEASLT 1047 >At5g64910.1 68418.m08165 expressed protein ; expression supported by MPSS Length = 487 Score = 30.3 bits (65), Expect = 0.89 Identities = 26/123 (21%), Positives = 48/123 (39%), Gaps = 1/123 (0%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNK-KSREFENKEAESSTYRDKNRSVNSGSERK 323 T E+ + +G E ++ E+ K +S+ E E DK + R+ Sbjct: 52 TEDKVESPAPEEEGKNEEEANENQEEEAAKVESKAAEEGGNEEEAKEDKEEEKEEAA-RE 110 Query: 322 SSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLL 143 ++EE + + S + +++P LRR KR KK++ +R K Sbjct: 111 DKEEEEEAVKPDESASQKEEAKGASSSEPQLRRGKRKRGTKTEAEKKVSTPRAKKRAKTT 170 Query: 142 SAK 134 A+ Sbjct: 171 KAQ 173 Score = 29.5 bits (63), Expect = 1.5 Identities = 27/133 (20%), Positives = 52/133 (39%), Gaps = 5/133 (3%) Frame = -2 Query: 514 IFETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG 335 + E T + ++ T + + ++ V + E + EN+E E++ K Sbjct: 34 VVEATTTQETQP-TQETEETEDKVESPAPEEEGKNEEEANENQEEEAAKVESKAAEEGGN 92 Query: 334 SERKSSGKDEEYSEQNSSNKSFND----GDARLTTKPNLRRLKRILPEIKR-KRKKLTQE 170 E K+EE E +K + D + K + P+++R KRK+ T+ Sbjct: 93 EEEAKEDKEEEKEEAAREDKEEEEEAVKPDESASQKEEAKGASSSEPQLRRGKRKRGTKT 152 Query: 169 ILTERTKLLSAKK 131 ++ AKK Sbjct: 153 EAEKKVSTPRAKK 165 >At5g37010.1 68418.m04438 expressed protein Length = 637 Score = 30.3 bits (65), Expect = 0.89 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 7/98 (7%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK-- 323 + S+ KT + GSK ++ +++ + E++EAE +R + R S ER+ Sbjct: 125 SNSAAAKTRRYSGSKRSFDFDQNGGDADAEDGG-EDEEAERRIHRQRQRGGESPRERRRR 183 Query: 322 --SSGKDEEYSEQNSSNK---SFNDGDARLTTKPNLRR 224 S +D+ S ++ S + S N G +R ++ RR Sbjct: 184 TPSRERDDSKSNRSGSRERGSSGNGGGSRRVSRSPGRR 221 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -2 Query: 406 SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE--QNSSNKSFNDGD 257 SRE ++ ++ S R++ S N G R+ S SE NSS S N + Sbjct: 186 SRERDDSKSNRSGSRERGSSGNGGGSRRVSRSPGRRSEINPNSSGNSVNSSN 237 >At4g35080.2 68417.m04981 high-affinity nickel-transport family protein contains Pfam domain, PF03824: High-affinity nickel-transport protein Length = 336 Score = 30.3 bits (65), Expect = 0.89 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = -2 Query: 373 STYRDKNRSVNSGSERKSSGKDEEYSE--QNSSNKSFNDGDARLTTKPNLRRLKRILPEI 200 ST+R ++R V+S S SS Y+ N++N SFN +KPN L RI Sbjct: 39 STHRPESRRVSSIS-CNSSQIPSLYTPIGSNTTNNSFNGSPKSDESKPNPGFLTRIATSA 97 Query: 199 KRKRKKLT 176 +RK L+ Sbjct: 98 SEQRKTLS 105 >At4g35080.1 68417.m04980 high-affinity nickel-transport family protein contains Pfam domain, PF03824: High-affinity nickel-transport protein Length = 365 Score = 30.3 bits (65), Expect = 0.89 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Frame = -2 Query: 373 STYRDKNRSVNSGSERKSSGKDEEYSE--QNSSNKSFNDGDARLTTKPNLRRLKRILPEI 200 ST+R ++R V+S S SS Y+ N++N SFN +KPN L RI Sbjct: 39 STHRPESRRVSSIS-CNSSQIPSLYTPIGSNTTNNSFNGSPKSDESKPNPGFLTRIATSA 97 Query: 199 KRKRKKLT 176 +RK L+ Sbjct: 98 SEQRKTLS 105 >At2g34300.1 68415.m04196 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 30.3 bits (65), Expect = 0.89 Identities = 18/82 (21%), Positives = 41/82 (50%), Gaps = 3/82 (3%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVER--EKSESNKKSREFENKEAESSTYRDKN-RSVNSGSERK 323 ++++ KT + ++ E EK+E+ ++ +E ++ + ++KN + V S S+ Sbjct: 89 ENNQVKTDSENSAEGNQVNESSGEKTEAGEERKESDDNNGDGDGEKEKNVKEVGSESDET 148 Query: 322 SSGKDEEYSEQNSSNKSFNDGD 257 + + + E NKS DG+ Sbjct: 149 TQKEKTQLEESTEENKS-EDGN 169 >At5g56360.1 68418.m07034 calmodulin-binding protein similar to alpha glucosidase II beta subunit from GI:2104691 [Mus musculus] Length = 647 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = -2 Query: 490 SSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 311 SSE + D S++ + E+E+S+ KK +F ++ E + + R V S + S K Sbjct: 310 SSEDSSSPTDESQNDGSAEKEESDEVKKVEDFVTEKKEELSKEELGRLVASRWTGEKSDK 369 Query: 310 DEE 302 E Sbjct: 370 PTE 372 >At5g25790.1 68418.m03061 tesmin/TSO1-like CXC domain-containing protein similar to SP|Q9Y4I5 Tesmin (Metallothionein-like 5, testis-specific) {Homo sapiens}; contains Pfam profile PF03638: Tesmin/TSO1-like CXC domain Length = 408 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 257 CSADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSERE 135 C + + S+K + SAR K +EK DT S G Y ER+ Sbjct: 295 CDEEHEIGSEK--ETSARVKTSQEKEDTDTSSGIYLEQERQ 333 >At5g19310.1 68418.m02301 homeotic gene regulator, putative similar to SP|P25439 Homeotic gene regulator (Brahma protein) {Drosophila melanogaster}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1064 Score = 29.9 bits (64), Expect = 1.2 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 3/84 (3%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTV---EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK 323 K ++TKT +GSK+ + + EK E ++ +E KE+E +K +++K Sbjct: 982 KRTDTKTRMSNGSKAEAVLSESDEEKEEEEEERKEESGKESEEE--NEKPLHSWKTNKKK 1039 Query: 322 SSGKDEEYSEQNSSNKSFNDGDAR 251 S S NS K + G R Sbjct: 1040 RSRYPVMTSSPNSRGKGSSKGSKR 1063 >At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein contains Pfam PF00096: Zinc finger, C2H2 type Length = 812 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 442 TVEREKSESNKKSREFENKEAESSTYR-DKNRSVNSGSERKSSGKDEE 302 TV R +S N + E E + +TYR DK +S G++ S+G ++ Sbjct: 701 TVRRLQSSQNPQEEEEEAISKDKNTYRSDKGKSQVVGTDSSSTGSKQQ 748 >At3g09710.1 68416.m01150 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 454 Score = 29.9 bits (64), Expect = 1.2 Identities = 21/79 (26%), Positives = 33/79 (41%) Frame = -2 Query: 403 REFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRR 224 R +E+ E E +T + N SV + + R S G + + KS N +TKPN Sbjct: 270 RPWESSEKEQNTTNNDNSSVKNSTNRNSQGGE--------TAKSSNRNKLNSSTKPNTPS 321 Query: 223 LKRILPEIKRKRKKLTQEI 167 RK++ + I Sbjct: 322 ASSTATRNPRKKRPIPSSI 340 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 29.5 bits (63), Expect = 1.5 Identities = 26/107 (24%), Positives = 46/107 (42%) Frame = -2 Query: 469 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQ 290 K+D ++ T REK + +KS + S R + G SSG++ Y Sbjct: 333 KKDREQAKATARREKKNAKRKSTTDSSASGSSLKKRKVCLETDIGC---SSGREVTYRVT 389 Query: 289 NSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTK 149 + K N G TK + +L ++R ++K+++E +T K Sbjct: 390 GENGK--NMGKLEHGTKESADKL-----SLRRTQRKISKENVTREVK 429 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 29.5 bits (63), Expect = 1.5 Identities = 26/107 (24%), Positives = 46/107 (42%) Frame = -2 Query: 469 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQ 290 K+D ++ T REK + +KS + S R + G SSG++ Y Sbjct: 333 KKDREQAKATARREKKNAKRKSTTDSSASGSSLKKRKVCLETDIGC---SSGREVTYRVT 389 Query: 289 NSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTK 149 + K N G TK + +L ++R ++K+++E +T K Sbjct: 390 GENGK--NMGKLEHGTKESADKL-----SLRRTQRKISKENVTREVK 429 >At2g28910.1 68415.m03513 CAX-interacting protein 4 (CAXIP4) contains Pfam domain PF00098: Zinc knuckle; identical to cDNA CAX-interacting protein 4 GI:27651998 Length = 332 Score = 29.5 bits (63), Expect = 1.5 Identities = 20/109 (18%), Positives = 46/109 (42%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 E + + E + KRD S + + + +KSR+ + + + D + S +S + Sbjct: 224 EGRSKRRKERRGRKRDEDDSDESEDEDDRRVKRKSRKEKRRRRSRRNHSDDSDSESSEDD 283 Query: 328 RKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKK 182 R+ +++ + +S D +R+ + R K+ RK ++ Sbjct: 284 RRQKRRNKVAASSDSEANVSGDDVSRVGRGSSKRSEKKSRKRHHRKERE 332 >At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 371 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/64 (25%), Positives = 33/64 (51%) Frame = -2 Query: 436 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 257 ERE+ E+ +K++ NKEAE+ T + + S E +D++ + + ++ + Sbjct: 296 EREQEETEQKAK---NKEAEAGTSKSSGDAEQSSKEVNEEEEDDDDDDDDLDMDELDELE 352 Query: 256 ARLT 245 A L+ Sbjct: 353 ASLS 356 Score = 27.5 bits (58), Expect = 6.2 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 400 EFEN-KEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 257 E+E +E E + + KN+ +G+ KSSG E+ S++ + + +D D Sbjct: 292 EYEREREQEETEQKAKNKEAEAGTS-KSSGDAEQSSKEVNEEEEDDDDD 339 >At2g17970.1 68415.m02084 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to At2g17960, At4g36090; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 507 Score = 29.5 bits (63), Expect = 1.5 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -2 Query: 313 KDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKR-ILPEIKRKRKKLTQEILTERTK 149 ++EE E++SS K F+ + KP L R +R L I KRKK I ER K Sbjct: 153 EEEEEEERDSSRKGFDASSMKTPEKPKLSRDQRENLRLINVKRKK--DFICLERVK 206 >At1g21630.1 68414.m02708 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain; ESTs gb|T44428 and gb|AA395440 come from this gene Length = 1218 Score = 29.5 bits (63), Expect = 1.5 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 3/80 (3%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVN---S 338 +TG +SS + ++ K+ R+K+ S S+ + EA+SS RS N Sbjct: 822 KTGKKQSSGEEDSEQSEGKTSDVDARDKNGSLDDSKVRKGIEADSSPRTKDTRSENGHDD 881 Query: 337 GSERKSSGKDEEYSEQNSSN 278 G S+GK Y + ++ Sbjct: 882 GESTASAGKTVNYDSHDETD 901 >At5g64810.1 68418.m08150 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 194 Score = 29.1 bits (62), Expect = 2.0 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 4/75 (5%) Frame = -2 Query: 490 SSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS----VNSGSERK 323 SSET TG+ GS S T+ +++S +N+ S+E + + + RS ++ G + + Sbjct: 58 SSETFTGESGGSGSATTLSKKES-TNRGSKESDQTKETGHRVAFRTRSKIDVMDDGFKWR 116 Query: 322 SSGKDEEYSEQNSSN 278 GK + N N Sbjct: 117 KYGKKSVKNNINKRN 131 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 29.1 bits (62), Expect = 2.0 Identities = 22/86 (25%), Positives = 44/86 (51%), Gaps = 8/86 (9%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSE-----SNKKSREFENKEA---ESSTYRDKNRSVN 341 ++SSE +T +DG T E+ +SE S++K E E++ A + ++++ N Sbjct: 2143 SQSSEPETINQDGDLDPETDEKVESERTPLHSDEKQEEQESENALNKQCEPIEAESQNTN 2202 Query: 340 SGSERKSSGKDEEYSEQNSSNKSFND 263 + E ++ +DEE + + N +D Sbjct: 2203 AEEEAEAQEEDEESMKMVTGNSLSDD 2228 >At5g12230.1 68418.m01435 expressed protein Length = 221 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/80 (16%), Positives = 40/80 (50%) Frame = -2 Query: 487 SETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 308 S++K+ +D + + + +++ ++ ++K + S +DK++ + ++ Sbjct: 116 SKSKSESKDRDRKHKKHKDRDKDKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDS 175 Query: 307 EEYSEQNSSNKSFNDGDARL 248 ++S+++ K +DGD L Sbjct: 176 GDHSKKHHDKKRKHDGDEDL 195 >At5g05240.1 68418.m00560 expressed protein similar to unknown protein (gb AAD32815.2) Length = 530 Score = 29.1 bits (62), Expect = 2.0 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = -2 Query: 502 GTNKSSETKTGKRDGSKSGVTVEREKSESNKKS--REFENKEAESSTYRDKNRSVNSGSE 329 G N +E G+ S S V + +K++ + +N +A SS D SV S Sbjct: 74 GKNIKTELLVGQEVKSSSSKLVLNTDVDCDKRALLKRCDNADAVSSCLNDDLTSVCSSRI 133 Query: 328 RKSSGKDEEYSEQNSSNKS 272 + + + YSE SSN S Sbjct: 134 SQKTSSMDVYSECGSSNGS 152 >At3g57300.1 68416.m06378 transcriptional activator, putative similar to transcriptional activator SRCAP [Homo sapiens] GI:5106572; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1507 Score = 29.1 bits (62), Expect = 2.0 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -3 Query: 531 KDTDDKYSRQEPINHQKRRQASVMARRAASQSKGKNPNPTR 409 +D D + + QEP+ ++ ++S RRAAS K + P + Sbjct: 1419 EDVDRQDNGQEPLEEPEKPKSSNKKRRAASNPKARAPQKAK 1459 >At3g48120.1 68416.m05248 expressed protein Length = 328 Score = 29.1 bits (62), Expect = 2.0 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = -2 Query: 466 RDGSKSGVTVEREKSESNKKSREFENKEAESSTY--RDKNRSVNSGSERKSSGKDEEYSE 293 R+ S+ RE+ E +K R S+Y R++ RS + +ER++ D E Sbjct: 92 RESSERRRYRSRERDERDKSHRRRSRSSERRSSYVDRERRRSRSRSAERRNRYGDRESRR 151 Query: 292 QNSSNKSFN 266 +++ ++S + Sbjct: 152 RSNRSRSLS 160 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/92 (19%), Positives = 37/92 (40%) Frame = -2 Query: 466 RDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQN 287 R + V+RE+ S +S E N+ + + R NRS + R+ +++ ++ Sbjct: 117 RSSERRSSYVDRERRRSRSRSAERRNRYGDRESRRRSNRSRSLSPRRERRSREDVKEKKP 176 Query: 286 SSNKSFNDGDARLTTKPNLRRLKRILPEIKRK 191 ++ D + ++K L E K Sbjct: 177 DYSRLIKGYDEMSAAEKVKAKMKLQLDETAEK 208 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/91 (20%), Positives = 41/91 (45%), Gaps = 8/91 (8%) Frame = -2 Query: 508 ETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 329 + G + ++ +GK DG + K +K R+++ +++ D + +GS+ Sbjct: 113 DEGDGEETKKSSGKSDGKHRESSRRESKDVDKEKDRKYKEGKSDKFYDGDDHHKSKAGSD 172 Query: 328 R-KSSGKD-------EEYSEQNSSNKSFNDG 260 + +S +D E Y+E+ S K + G Sbjct: 173 KTESKAQDHARSPGTENYTEKRSRRKRDDHG 203 >At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 668 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 230 KKVEKNSARDKKEKEKTDTRNSDGTY 153 K+ E+ + DKK KEK D RN+ TY Sbjct: 551 KEAEEFAEEDKKVKEKIDARNALETY 576 >At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1) SWISS-PROT:Q9LKR3 PMID:8888624 Length = 669 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 230 KKVEKNSARDKKEKEKTDTRNSDGTY 153 K+ E+ + DKK KEK D RN+ TY Sbjct: 551 KEAEEFAEEDKKVKEKIDARNALETY 576 >At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative strong similarity to gi:4467359 Length = 1116 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/68 (20%), Positives = 29/68 (42%) Frame = -2 Query: 532 KGY*R*IFETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKN 353 +G+ + +F N+ + D K G + K + ++K E E + + Y D+ Sbjct: 354 EGFFKKLFHESKNEDDKVSNAVDDEEKDGFLKKLFKEKFDEKRNGNERNETDETVYTDET 413 Query: 352 RSVNSGSE 329 ++G E Sbjct: 414 SGEDNGRE 421 >At4g35940.1 68417.m05113 expressed protein Length = 451 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -1 Query: 266 RRRCSADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRVN 111 RR D + K ++ EK ++KK KE+ R KE ++V+ Sbjct: 43 RRSDKKDKKDKKERKEKKEKKEKKRKEREGKEVGSEKRSHKRRRKEDGAKVD 94 >At4g00480.1 68417.m00066 myc-related transcription factor (MYC1) identical to ATMYC1 GI:1853965 from [Arabidopsis thaliana] Length = 526 Score = 28.7 bits (61), Expect = 2.7 Identities = 18/52 (34%), Positives = 22/52 (42%) Frame = -2 Query: 514 IFETGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRD 359 I ET N TK G VTV R+K+ K +E E +YRD Sbjct: 415 IEETSGNYDDSTKIDDNSGETEQVTVFRDKTHLRVKLKETEVVIEVRCSYRD 466 >At3g25840.1 68416.m03219 protein kinase family protein contains Pfam profile: PF00069 eukaryotic protein kinase domain Length = 935 Score = 28.7 bits (61), Expect = 2.7 Identities = 23/103 (22%), Positives = 44/103 (42%) Frame = -2 Query: 478 KTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 299 ++ +RD + G +R+ S ++ ++ + + R+K R + S ER+ K+ E Sbjct: 257 RSKERDMDREGSIRDRDSEGSKRRDKDSDRRRERE---REKRREIESDRERRKE-KERER 312 Query: 298 SEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQE 170 S K +GD L + N R R + +K +E Sbjct: 313 SIDRDRRKE-REGD-YLRDRANERGRSRDRTRYNSRERKREKE 353 >At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing protein contains Pfam domain PF03194: LUC7 N_terminus Length = 402 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 5/80 (6%) Frame = -2 Query: 430 EKSESNK-KSREFENKEAESSTYRDK----NRSVNSGSERKSSGKDEEYSEQNSSNKSFN 266 EK+ K +S+E +KE ESS R+K +R +R+S +D + ++ ++ Sbjct: 311 EKANIRKERSKERNSKERESSKDREKEQETSREHRRDYDRRSRDRDRHHDRDREQDRDYD 370 Query: 265 DGDARLTTKPNLRRLKRILP 206 +R + R R P Sbjct: 371 RSHSRSRRRSRSRSRSRDRP 390 >At2g33480.1 68415.m04104 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; Length = 268 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/69 (28%), Positives = 34/69 (49%) Frame = -2 Query: 358 KNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKL 179 K RS NS S+RK K+E +E+ + + + + + +T P R + KR+R++ Sbjct: 160 KKRS-NSNSKRKEDEKEEVENEKETETEREREEENKKSTCPIFYDFMRKDTKKKRRRRRC 218 Query: 178 TQEILTERT 152 LT T Sbjct: 219 CDLNLTPAT 227 >At1g79200.1 68414.m09234 expressed protein Length = 159 Score = 28.7 bits (61), Expect = 2.7 Identities = 19/120 (15%), Positives = 51/120 (42%), Gaps = 1/120 (0%) Frame = -2 Query: 490 SSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 311 S E K + S + EK + ++ + + + + + S +DK + S K Sbjct: 7 SKEKKRSRARSEDSSSSDYEEKVKRHRGTEKDDERRSRRSDKKDKKSHKHHKSSTSKKSK 66 Query: 310 DEEYSEQNS-SNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLLSAK 134 D++ ++++ S+ +G L+ + + +K +++ ++ TE + L ++ Sbjct: 67 DDKPKKKHTESDHKLKEGIPELSMEDYFSKNNEFATWLKEEKRTYFNDLTTEAARGLFSR 126 >At1g73960.1 68414.m08565 expressed protein similar to TATA binding protein associated factor (GI:2827282) [Homo sapiens]; similar to Transcription initiation factor TFIID 150 kDa subunit (TAFII-150) (TAFII150) (Swiss-Prot:Q24325) [Drosophila melanogaster] Length = 1390 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -1 Query: 251 ADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSR 117 A QT S EK +DK++KEK R D Y +R K++ R Sbjct: 1278 ASLQTLSIGKEKEKKKDKEKKEKKRKR-EDPVYLEKKRLKKEKKR 1321 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 28.7 bits (61), Expect = 2.7 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = -2 Query: 496 NKSSETKTGKRDGSK-SGVTVEREKSESNKKSREFE-NKEAESSTYRDKNRSVNSGSERK 323 +KS E+ K+D SK S E + + K R+ E +++ E S RD+ +S + +R+ Sbjct: 34 SKSRESHDLKKDSSKISEKDNENGRDKDGNKDRDREKDRDREKSRDRDREKSRDRDRDRE 93 Query: 322 SSGKDEE 302 S KD + Sbjct: 94 RS-KDRQ 99 >At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family protein / snRNP family protein contains similarity to U4/U6 small nuclear ribonucleoprotein hPrp3 [Homo sapiens] gi|2708307|gb|AAC51926 Length = 786 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 6/79 (7%) Frame = -2 Query: 505 TGTNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENK---EAESSTYRD---KNRSV 344 T + + G+R+GS+ E+S K +E +K E + RD K+R Sbjct: 61 TKDRRGRSVERGEREGSRDREKHHHERSHEGSKEKESRSKRKDREEENGARDGKKKSRFA 120 Query: 343 NSGSERKSSGKDEEYSEQN 287 + ER+S +D +N Sbjct: 121 DGNGERRSRFEDVAIEVEN 139 >At1g21390.1 68414.m02676 expressed protein Length = 248 Score = 28.7 bits (61), Expect = 2.7 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = -2 Query: 490 SSETKTGKRDGSKSGVTVEREKSESNKK--SREFENKEAESSTYRDKNRSVNSGSERKSS 317 +++ K K+ V+ SE K +E+ N+ +ESST R + S N+ +SS Sbjct: 156 TTKKKKKKKKDEACKVSPRPSISEETVKVEDKEWWNRMSESSTKRSGSSSSNNSIRSRSS 215 Query: 316 GKDEEYS 296 +DE+ S Sbjct: 216 LRDEKSS 222 >At1g15940.1 68414.m01913 expressed protein similar To androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens] Length = 990 Score = 28.7 bits (61), Expect = 2.7 Identities = 30/126 (23%), Positives = 60/126 (47%), Gaps = 4/126 (3%) Frame = -2 Query: 508 ETGTNKSSETKTGKR---DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRS-VN 341 +T K TK+ + DG K+G + ++EK+++ + AE+ + + V+ Sbjct: 445 KTNPAKEDLTKSNVKKHEDGIKTGKSSKKEKADNGLAKTSAKKPLAETMMVKPSGKKLVH 504 Query: 340 SGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILT 161 S +++K+S + S+KS D+R TT P ++ ++ P+ K K++ E + Sbjct: 505 SDAKKKNSEGASMDTPIPQSSKS-KKKDSRATT-PATKKSEQ-APKSHPKMKRIAGEEVE 561 Query: 160 ERTKLL 143 T L Sbjct: 562 SNTNEL 567 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 28.3 bits (60), Expect = 3.6 Identities = 21/103 (20%), Positives = 49/103 (47%), Gaps = 5/103 (4%) Frame = -2 Query: 478 KTGKRDGSKSGVTVEREKSESNKKSREFE--NKE--AESSTYRDKNRSVNSGSERKSSGK 311 +T K+ +G + + ++S KK+ E NK+ A S ++ + + E++ + Sbjct: 487 RTPKKSSPAAGSSSSKRSAKSQKKTEEATRTNKKSVAHSDDESEEEKEDDEEEEKEQEVE 546 Query: 310 DEEYSEQNS-SNKSFNDGDARLTTKPNLRRLKRILPEIKRKRK 185 +EE +N +KS ++ ++ N+ + E K+K++ Sbjct: 547 EEEEENENGIPDKSEDEAPQLSESEENVESEEESEEETKKKKR 589 Score = 27.1 bits (57), Expect = 8.3 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 6/83 (7%) Frame = -2 Query: 493 KSSETKTGKR-DGSKSGVTVEREKSESN----KKSREFENKEAES-STYRDKNRSVNSGS 332 K+S+ +GK + SG V+ K E + K + E K+ E S DK V Sbjct: 22 KTSDAISGKEVQENASGKEVQESKKEEDTGLEKMEIDDEGKQHEGESETGDKEVEVTE-E 80 Query: 331 ERKSSGKDEEYSEQNSSNKSFND 263 E+K G+D+E E + ++ +D Sbjct: 81 EKKDVGEDKEQPEADKMDEDTDD 103 >At5g27860.1 68418.m03342 expressed protein Length = 177 Score = 28.3 bits (60), Expect = 3.6 Identities = 34/126 (26%), Positives = 50/126 (39%), Gaps = 6/126 (4%) Frame = -2 Query: 496 NKSSETKTGKRDGSKSGVTVEREKSESNKKS---REFENKEAESSTY--RDKNRSVNSGS 332 + S + + D S E EKS +KK ++ ++KE S R KNR G Sbjct: 57 HSSDSSDSSYSDSSSESSDSEHEKSRRHKKHEKPKKAKDKERSKSHRHKRHKNRERKKGE 116 Query: 331 ERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEI-KRKRKKLTQEILTER 155 SSG N+ +DG+ R K+IL ++ K K K + E Sbjct: 117 GEGSSG---PVKLSKFLNRDKDDGERRSAVSG-----KKILLKVDKSKEDKAAESKRNEL 168 Query: 154 TKLLSA 137 K L+A Sbjct: 169 LKFLNA 174 >At5g27120.1 68418.m03237 SAR DNA-binding protein, putative strong similarity to SAR DNA-binding protein-1 [Pisum sativum] GI:3132696; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 533 Score = 28.3 bits (60), Expect = 3.6 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 K + K K D + T E K +SNKK E E + AE ++K ++K Sbjct: 457 KKDKKKKKKADDEEEAKTEEPSKKKSNKKKTEAEPETAEEPAKKEK--------KKKRKH 508 Query: 313 KDEE 302 ++EE Sbjct: 509 EEEE 512 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = -1 Query: 260 RCSADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRVN 111 R +A+ + ++VEK A+D K KEK ++S+ K E EKE+ ++ Sbjct: 418 RSNAEQPKEKEEVEKEKAKDTK-KEKGKEKDSE---KKMEHEKEKGKSLD 463 >At1g70505.1 68414.m08114 expressed protein Length = 338 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = -2 Query: 460 GSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 302 G S V++ R +S N ++R + E TYR + NS + SSG D E Sbjct: 148 GLGSLVSIYRFRSPDNGENR-VSIVDEEQGTYRPPGNAENSNVFKSSSGHDRE 199 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 28.3 bits (60), Expect = 3.6 Identities = 21/72 (29%), Positives = 34/72 (47%) Frame = -2 Query: 472 GKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 293 G+ GS+ G + + + K SR+ E ++T RD S NSG R S ++E+ S Sbjct: 470 GEEGGSEYGGYEDETQEKEEKPSRDKER----ATTERDW--SENSGDRRHKSHREEKDSH 523 Query: 292 QNSSNKSFNDGD 257 + + D D Sbjct: 524 REYKQQRDRDSD 535 >At1g01440.1 68414.m00059 extra-large G-protein-related weak similarity to extra-large G-protein (AtXLG1) (GI:3201682) [Arabidopsis thaliana] Length = 664 Score = 28.3 bits (60), Expect = 3.6 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 4/70 (5%) Frame = -2 Query: 469 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS--GSER--KSSGKDEE 302 + G G +S+ ++ +E N+ A +S R++ NS GS+R KSS K+EE Sbjct: 2 RTSGDVYGADTGSSRSDEDRGFKEDLNESA-TSPMRNRLDDSNSRPGSQRFVKSSRKEEE 60 Query: 301 YSEQNSSNKS 272 +SS+K+ Sbjct: 61 TDSDSSSSKN 70 >At5g50840.2 68418.m06299 expressed protein Length = 405 Score = 27.9 bits (59), Expect = 4.7 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 2/118 (1%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 K E KR GSK+ E+E E K ++ ++ + T RDK S+ +R++ Sbjct: 119 KQQEVVESKRKGSKNMFKSEKEFLEFMLKYQQVLSERDSAITVRDKLESLCRELQRQNKM 178 Query: 313 KDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTE--RTKL 146 EE ++ ++ + L+TK + + ++K + LTQ E RTKL Sbjct: 179 LMEECKRVSTEGQTLR---SDLSTKFQDAIMDVSIKLDEQKNESLTQLKENEMLRTKL 233 >At5g50840.1 68418.m06298 expressed protein Length = 404 Score = 27.9 bits (59), Expect = 4.7 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 2/118 (1%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 K E KR GSK+ E+E E K ++ ++ + T RDK S+ +R++ Sbjct: 118 KKQEVVESKRKGSKNMFKSEKEFLEFMLKYQQVLSERDSAITVRDKLESLCRELQRQNKM 177 Query: 313 KDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTE--RTKL 146 EE ++ ++ + L+TK + + ++K + LTQ E RTKL Sbjct: 178 LMEECKRVSTEGQTLR---SDLSTKFQDAIMDVSIKLDEQKNESLTQLKENEMLRTKL 232 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 27.9 bits (59), Expect = 4.7 Identities = 23/90 (25%), Positives = 39/90 (43%) Frame = -2 Query: 385 EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILP 206 E E D+N S + E SSGK++E ++S +S + + L+R Sbjct: 777 EPEVDILSDENDSEYNVPEEYSSGKEQECLNSSTSGESGSSSGESYEDDDHQNSLRR--- 833 Query: 205 EIKRKRKKLTQEILTERTKLLSAKKNNLLE 116 KRK+ K I+T + + + + LE Sbjct: 834 -SKRKKHKKEAGIMTSSGRRVKKRNFDELE 862 >At5g43130.1 68418.m05265 transcription initiation factor IID (TFIID) component TAF4 family protein weak similarity to SP|O00268 Transcription initiation factor TFIID 135 kDa subunit {Homo sapiens}; contains Pfam profile PF05236: Transcription initiation factor TFIID component TAF4 family Length = 712 Score = 27.9 bits (59), Expect = 4.7 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = -2 Query: 424 SESNKKSRE-FENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDARL 248 +E N+K +E +E K+AE+ + + S G S KD+E + + D D Sbjct: 543 NEMNQKVKEEWEKKQAEAEKLKKPSES-EEGDGGVDSEKDKEDNRSKGVKGNKEDDDKMR 601 Query: 247 TTKPNL 230 TT N+ Sbjct: 602 TTAANV 607 >At4g29940.1 68417.m04259 pathogenesis-related homeodomain protein (PRHA) identical to Pathogenesis-related homeodomain protein (PRHA) (SP:P48785) [Arabidopsis thaliana) Length = 796 Score = 27.9 bits (59), Expect = 4.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 224 VEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRV 114 VE+N K KE + +S+ + KT+ EKE S++ Sbjct: 619 VEENETESKMMKEPHEELSSEMSLKTAAEEKETESKM 655 >At2g28150.1 68415.m03419 expressed protein Length = 540 Score = 27.9 bits (59), Expect = 4.7 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 3/100 (3%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSS--GK 311 ETK K+D + S +++R S + ++ + AE+ + + N S + SS GK Sbjct: 407 ETKLQKKDAADSNASLKRSSSYNGDRASN-QMGVAENGDSKPDSSKNNPSSRKASSILGK 465 Query: 310 DEE-YSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKR 194 + SE+ + + TTK + KRI +++ Sbjct: 466 QQPLVSEKRRDSSEDTTKNIPCTTKTHDACSKRITESLRK 505 >At2g27170.1 68415.m06029 structural maintenance of chromosomes (SMC) family protein similar to basement membrane-associated chondroitin proteoglycan Bamacan [Rattus norvegicus] GI:1785540; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain. No suitalble start codon was identified. Length = 1207 Score = 27.9 bits (59), Expect = 4.7 Identities = 27/108 (25%), Positives = 40/108 (37%) Frame = -2 Query: 469 KRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQ 290 K D + TVERE +S RE E + + DK + Y +Q Sbjct: 323 KNDALEQLNTVEREMQDS---LRELEAIKPLYESQVDKENQTSKRINELEKTLSILYQKQ 379 Query: 289 NSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKL 146 + + N + + LKR+L + +KL EIL T L Sbjct: 380 GRATQFSNKAARDKWLRKEIEDLKRVLDSNTVQEQKLQDEILRLNTDL 427 >At1g74830.1 68414.m08670 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593 Length = 542 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -2 Query: 424 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 263 SE K+ E + EAE YR+K + + + EE+ +QN + +++D Sbjct: 378 SELAKREEEMKELEAEFEVYREKYGCLTDQEDAR-----EEFHKQNGNASAYDD 426 >At5g62750.1 68418.m07877 expressed protein predicted proteins, Caenorhabditis elegans Length = 124 Score = 27.5 bits (58), Expect = 6.2 Identities = 23/108 (21%), Positives = 54/108 (50%), Gaps = 6/108 (5%) Frame = -2 Query: 421 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS----FNDGDA 254 E+ +K + +NKE E N++ + E+K KD++ ++N +K+ + Sbjct: 3 ETEEKVKNHDNKEEEH------NKAEKA--EKKEKKKDKDKKDKNEDDKNGGGEEGEDQE 54 Query: 253 RLTTKPNLRRLKRILPEIKRKRKKLTQEI--LTERTKLLSAKKNNLLE 116 + + K + + K PE K+ +KL ++ + E+ + + KK+ +++ Sbjct: 55 KKSKKKDKKAKKEKNPEDKKDPEKLKMKLQKIEEKIQAMVLKKDEIVK 102 >At5g55300.1 68418.m06891 DNA topoisomerase I identical to Swiss-Prot:P30181 DNA topoisomerase I [Arabidopsis thaliana] Length = 916 Score = 27.5 bits (58), Expect = 6.2 Identities = 18/80 (22%), Positives = 37/80 (46%) Frame = -2 Query: 481 TKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 302 +K K D S S + + K+ + +A + ++R++ +++ + KD + Sbjct: 297 SKRFKSDSSNSNTSSAKPKAVKLNSTSSAAKPKARN-VVSPRSRAMTKNTKKVT--KDSK 353 Query: 301 YSEQNSSNKSFNDGDARLTT 242 YS + S+ S DG + TT Sbjct: 354 YSTSSKSSPSSGDGQKKWTT 373 >At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 930 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = -2 Query: 433 REKSESNKKSREFENKEAESSTYRDKNRSVNSG----SERKSSGKDEEYSEQNSSNKSFN 266 +EK E S ++E +S R+K+ SG S +SSG + N ++ N Sbjct: 801 KEKVEEKTSSLTLGSEEEKSRKKREKSPGKRSGGNDLSSSESSGDERRRKRYNKKDRHRN 860 Query: 265 DGDA 254 D ++ Sbjct: 861 DSES 864 >At5g05050.1 68418.m00536 peptidase C1A papain family protein weak similarity to berghepain-2 [Plasmodium berghei] GI:17978639; contains Pfam profile PF00112: Papain family cysteine protease Length = 299 Score = 27.5 bits (58), Expect = 6.2 Identities = 18/72 (25%), Positives = 33/72 (45%) Frame = -2 Query: 472 GKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 293 G+ G+KS E + K + SS+ KN+S S ++ + +DEE+++ Sbjct: 30 GRNGGNKSDSDEESAVVGVGAGRKGKNKKSSSSSSSSKKNKSPAKASTKRFTKEDEEWAK 89 Query: 292 QNSSNKSFNDGD 257 S+ + N D Sbjct: 90 DLPSDFTTNCKD 101 >At4g40020.1 68417.m05666 hypothetical protein Length = 615 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = -1 Query: 242 QTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRVN 111 + K KK EK +KKEK+++ + + K ++EK++ + N Sbjct: 399 EEKEKKEEKKE--NKKEKKESKKEKKEHSEKKEDKEKKEQTHQN 440 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 4/67 (5%) Frame = -2 Query: 454 KSGVTVERE----KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQN 287 K +T+E++ + E +K E E KE + S R+K + K GK+++ E + Sbjct: 520 KEIITLEKQVKLLEEEEKEKREEEERKEKKRSKEREKKLRKKERLKEKDKGKEKKNPECS 579 Query: 286 SSNKSFN 266 + N Sbjct: 580 DKDMLLN 586 >At3g23540.1 68416.m02962 expressed protein ; expression supported by MPSS Length = 568 Score = 27.5 bits (58), Expect = 6.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 502 GTNKSSETKTGKRDGSKSGVTVEREKSESNK 410 G+ E++TG G+K+ VTVER S K Sbjct: 520 GSLSQKESETGDVPGTKATVTVERSSSAPGK 550 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/54 (18%), Positives = 25/54 (46%) Frame = -2 Query: 424 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 263 +++N + N + + +D N + N+ + ++G D + N +N N+ Sbjct: 82 NDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNNN 135 >At2g32250.2 68415.m03942 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282; contains Pfam:PF03101 domain: FAR1 family Length = 805 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -2 Query: 463 DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 305 + S SG + + +FE+KEA YR+ RSV G K+S + + Sbjct: 22 EASTSGNVAQCATVSELRNGMDFESKEAAYYFYREYARSVGFGITIKASRRSK 74 >At2g32250.1 68415.m03941 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282; contains Pfam:PF03101 domain: FAR1 family Length = 807 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = -2 Query: 463 DGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 305 + S SG + + +FE+KEA YR+ RSV G K+S + + Sbjct: 22 EASTSGNVAQCATVSELRNGMDFESKEAAYYFYREYARSVGFGITIKASRRSK 74 >At1g69280.1 68414.m07943 expressed protein Length = 400 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Frame = -2 Query: 331 ERKSSGK-DEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQEILTER 155 E K+SG+ +++ S N S ++ D + T + + + + K+K+KK T++ +T++ Sbjct: 231 EDKASGECEDKSSNSNVSWRNIGDCNNSDETPSSTQSFSYPITKKKKKKKKATKKKMTQQ 290 Query: 154 TKLLSAKK 131 + KK Sbjct: 291 QQQQKQKK 298 >At1g61040.1 68414.m06872 plus-3 domain-containing protein contains Pfam profile PF03126: Plus-3 domain Length = 643 Score = 27.5 bits (58), Expect = 6.2 Identities = 24/90 (26%), Positives = 36/90 (40%) Frame = -2 Query: 433 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 254 R+ S+ SR+F SST R S N S +S S+ SN D D Sbjct: 203 RDASKGGSGSRDF------SSTKRKPLASSNLSSSSQSDSDSRSQSDDEGSNGGMLDSDD 256 Query: 253 RLTTKPNLRRLKRILPEIKRKRKKLTQEIL 164 + P +K E+ +R KL + ++ Sbjct: 257 DRSDVPTFEDVK----EVTIRRSKLAKWLM 282 >At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calreticulin (crt1) GI:2052379 [Arabidopsis thaliana] Length = 425 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/74 (22%), Positives = 30/74 (40%) Frame = -2 Query: 493 KSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSG 314 K +E GK ++ E EK ++S++ AES + N G + + Sbjct: 345 KLAEETWGKHKDAEKAAFDEAEKKREEEESKD---APAESDAEEEAEDDDNEGDDSDNES 401 Query: 313 KDEEYSEQNSSNKS 272 K EE E + ++ Sbjct: 402 KSEETKEAEETKEA 415 >At1g55460.1 68414.m06343 Kin17 DNA-binding protein-related contains similarity to zinc finger protein rts2 GB:U16133 GI:563244 from [Saccharomyces cerevisiae] Length = 411 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -2 Query: 352 RSVNSGSERKSSGK----DEEYSEQNSSNKSFNDGDARLTTKPNLRRLKRILPEIKRKRK 185 + V +G ER S K DEE + K GD+ + K L ++ E ++K++ Sbjct: 230 KQVATGKERGESSKLLFGDEENDKVERGEKRKRSGDSGRSEKERRSALDELMKEEEKKKE 289 Query: 184 KLTQE 170 ++ ++ Sbjct: 290 RMNRK 294 >At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 327 Score = 27.5 bits (58), Expect = 6.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 379 ESSTYRDKNRSVNSGSERKSSGKDEEYSE 293 ++ + R+ RS + GSER+ GK++E+ E Sbjct: 288 QARSSREGYRSGSVGSERRGKGKEKEFGE 316 >At1g29000.1 68414.m03546 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 287 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = -1 Query: 248 DXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQ 126 + + K ++ +K D+K+KE+ + + K E++KE+ Sbjct: 191 EDKKKKEEEDKKKKEDEKKKEEEKKKEEENKKKEGEKKKEE 231 >At1g16220.1 68414.m01942 protein phosphatase 2C family protein / PP2C family protein similar to protein phosphatase-2C; PP2C (GI:3643088) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain; Length = 491 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = -1 Query: 254 SADXQTKSKKVEKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSRV 114 S + T+S + + DKKE+ T+T + ++ E + +S R+ Sbjct: 394 SHEESTESVTITSSKDADKKEEASTETNETVPVWEIKEEKTPESCRI 440 >At1g05910.1 68414.m00620 cell division cycle protein 48-related / CDC48-related similar to SP|P54609 Cell division cycle protein 48 homolog {Arabidopsis thaliana}; contains Pfam profiles PF00004: ATPase AAA family, PF00439: Bromodomain Length = 1210 Score = 27.5 bits (58), Expect = 6.2 Identities = 16/83 (19%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Frame = -2 Query: 499 TNKSSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS 320 T+KS + + + G+ R + +NK+ + + ++S +D +G+E Sbjct: 127 TSKSRKDMDAELAPRREGLRPRRSTTIANKRLKTESGADQDTSEEKDGQDETENGNELDD 186 Query: 319 S--GKDEEYSEQNSSNKSFNDGD 257 + G++E +E + + DG+ Sbjct: 187 ADDGENEVEAEDEGNGEDEGDGE 209 >At5g66950.1 68418.m08440 expressed protein Length = 870 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -2 Query: 433 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 263 REKS+ N R N++ S R RSV+ G S DE+ E S+ ++D Sbjct: 631 REKSQYNG-GRLLVNEDEHPSKRRVSFRSVDHGEASVISLGDEDEEEDGSNGVEWDD 686 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/85 (22%), Positives = 34/85 (40%) Frame = -2 Query: 490 SSETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 311 S+E +T + D + V + + + S E E ++ + + S +SGS S G Sbjct: 498 SAEKRTRRGDAGEEDVDIGEDIPIEDYPSVEIE-RDGTAVAAAASSGSSSSGSSSSSGGS 556 Query: 310 DEEYSEQNSSNKSFNDGDARLTTKP 236 + + S +D DA P Sbjct: 557 SSSSDSGSGGSSSGSDSDADSVQSP 581 >At5g63550.1 68418.m07976 expressed protein Length = 530 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 534 RKDTDDKYSRQEPINHQKRRQASVMARRAASQSKGKNPNPT 412 + DTDD+ E K++ +S +S SKGK+ P+ Sbjct: 321 KTDTDDEKDEVEVEKPSKKKSSSKKTVEESSGSKGKDKQPS 361 >At5g58880.1 68418.m07377 hypothetical protein Length = 1088 Score = 27.1 bits (57), Expect = 8.3 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 1/82 (1%) Frame = -2 Query: 457 SKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 278 ++ + +E E + +++ KEA T D ++SV S RKS K+ E +++ SN Sbjct: 363 TRKRLDLENEYIDHTEQNLPLNGKEA---TIEDDDKSVVS---RKSEEKEVEMNDETDSN 416 Query: 277 K-SFNDGDARLTTKPNLRRLKR 215 K +D ++ L RL + Sbjct: 417 KEECDDSSCSEESESELCRLNK 438 >At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative Length = 739 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/90 (21%), Positives = 42/90 (46%) Frame = -2 Query: 430 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDAR 251 +K + + + E+K+ + R+K R ++ + +DEE E+ + S + D Sbjct: 640 KKVGAEMRKADIEDKKVDKERRREK-RMKQKIKRKRGAMEDEEEEEEEDHDGSGSSDD-- 696 Query: 250 LTTKPNLRRLKRILPEIKRKRKKLTQEILT 161 T N +R K+I+ + + K+ + L+ Sbjct: 697 -ETGRNSKRAKKIVSDNEENGGKINTDSLS 725 >At5g51410.2 68418.m06374 LUC7 N_terminus domain-containing protein similar to cisplatin resistance-associated overexpressed protein [Homo sapiens] GI:6899846; contains Pfam profile PF03194: LUC7 N_terminus Length = 334 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 221 EKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSR 117 E+ +A+DK ++E+ R + K REKE S+ Sbjct: 231 EQKAAKDKGKEEERLVRGKEADDKRKPREKESESK 265 >At5g51410.1 68418.m06373 LUC7 N_terminus domain-containing protein similar to cisplatin resistance-associated overexpressed protein [Homo sapiens] GI:6899846; contains Pfam profile PF03194: LUC7 N_terminus Length = 334 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 221 EKNSARDKKEKEKTDTRNSDGTYKTSEREKEQSSR 117 E+ +A+DK ++E+ R + K REKE S+ Sbjct: 231 EQKAAKDKGKEEERLVRGKEADDKRKPREKESESK 265 >At5g44690.1 68418.m05476 hypothetical protein Length = 684 Score = 27.1 bits (57), Expect = 8.3 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = -2 Query: 487 SETKTGKRDGSKSGVTVEREKSESNKK---SREFENKEAESSTYRDKNRSVNSGSERKSS 317 +E + +R + G ++E E+ SN + S ++E + T R R SG E KSS Sbjct: 366 TEGRNEERRKKEEGKSMEIEEYRSNPQEVTSVVCLDREKDEETARQVFRE--SGKEEKSS 423 Query: 316 GKDEEYSE 293 DEE S+ Sbjct: 424 QNDEETSK 431 >At4g09890.1 68417.m01620 expressed protein Length = 87 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -2 Query: 340 SGSERKSSGKDEEYS-EQNSSNKSFNDGDARLTTKPNLRRLKRI 212 S +E SS +E+ +QN SN S+N + T P ++R KR+ Sbjct: 7 SYTEYSSSFSTDEFGYDQNRSN-SYNFNGPCINTDPEMKRKKRV 49 >At3g61380.1 68416.m06869 expressed protein Length = 718 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -1 Query: 263 RRCSADXQTKSKKVEKNSARDKKE---KEKTDTRNSDGTYKTSEREKE 129 + CS + +SK EK+ DK+E E+T + T +SE K+ Sbjct: 254 QNCSTQEEIQSKSEEKHDVSDKEEPFCDERTTEDGKEETIYSSEDSKK 301 >At3g45400.1 68416.m04901 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 475 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 468 LPVFVSDDLLVPVSNIYRQYPFSIFV 545 +PV +SDD+ +P ++ FS+FV Sbjct: 355 VPVIISDDIELPFEDVIDYSEFSVFV 380 >At3g20550.1 68416.m02601 forkhead-associated domain-containing protein / FHA domain-containing protein weak similarity to SP|Q28147 Nuclear inhibitor of protein phosphatase-1 (NIPP-1) (Protein phosphatase 1, regulatory inhibitor subunit 8) {Bos taurus}; contains Pfam profile PF00498: FHA domain Length = 314 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/74 (21%), Positives = 30/74 (40%) Frame = -2 Query: 436 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 257 E+E S ++ + +E +S RD++ + ERK G+ + D + Sbjct: 21 EKEIGRSREREDDGREREKRNSRERDRDIGRDRDRERKGEGERDREVGDKRRRSGREDTE 80 Query: 256 ARLTTKPNLRRLKR 215 R T+ + R R Sbjct: 81 KRRRTRTDDERYSR 94 >At3g12010.1 68416.m01488 expressed protein contains Prosite PS00626: Regulator of chromosome condensation (RCC1) signature 2 Length = 685 Score = 27.1 bits (57), Expect = 8.3 Identities = 24/92 (26%), Positives = 45/92 (48%), Gaps = 3/92 (3%) Frame = -2 Query: 340 SGSERKSSGKDEEYSEQNSSNKS---FNDGDARLTTKPNLRRLKRILPEIKRKRKKLTQE 170 S + ++ K+ E SE ++SN++ + DG L L + ++L +I + ++ Sbjct: 313 SETSSQAVNKEIESSESSTSNENIVMYEDGWTFLVPDLILDQTNKVLWKIHLDLEAISAS 372 Query: 169 ILTERTKLLSAKKNNLLE*IKVRAATLGIPRS 74 ++RT LL + LE K + LGI R+ Sbjct: 373 S-SDRTSLLEFLQRRKLEANKAKQLCLGIARA 403 >At3g11590.1 68416.m01416 expressed protein Length = 622 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -2 Query: 415 NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 269 N+++ ++ N +Y ++ V +G+E S D E N NKS+ Sbjct: 461 NEEAGDYLNHHISFGSYNIEDGEVENGNEEGSGESDLHSIELNIDNKSY 509 >At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative similar to RNA helicase GB:A57514 GI:897915 from [Rattus norvegicus]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 989 Score = 27.1 bits (57), Expect = 8.3 Identities = 22/99 (22%), Positives = 47/99 (47%), Gaps = 4/99 (4%) Frame = -2 Query: 433 REKSESNKKSREFENKEAESSTYR---DKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 263 +++ S K++ + E S R ++ + +RKSS +EE E++S + + Sbjct: 14 KDRDRSKKENGRRDTTEMRSRVKRCDSEEEERIRIRRDRKSSDFEEEEYERDSKRRGEDK 73 Query: 262 GDARL-TTKPNLRRLKRILPEIKRKRKKLTQEILTERTK 149 G R + + LKR +R+++K ++ ER++ Sbjct: 74 GRGRRERDRDRGKYLKRDRERREREKEKGRKKQKKERSR 112 >At3g09450.1 68416.m01123 hypothetical protein Length = 775 Score = 27.1 bits (57), Expect = 8.3 Identities = 19/67 (28%), Positives = 28/67 (41%) Frame = -2 Query: 253 RLTTKPNLRRLKRILPEIKRKRKKLTQEILTERTKLLSAKKNNLLE*IKVRAATLGIPRS 74 +L + L RL + EI R T ++L R LSA N L+ IK+ + R Sbjct: 184 KLYAENALERLNMFV-EIMMARDNTTAQVLIARAASLSAAAKNTLKNIKIHHERISWERP 242 Query: 73 QTNLAEK 53 T + Sbjct: 243 DTRFLSR 249 >At2g46510.1 68415.m05796 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 566 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = -2 Query: 460 GSKSGVTVEREKSESNK--KSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 302 G G E + E +K +S F N AE T++D + V R G DE+ Sbjct: 85 GWGDGCCREPNEEEESKVVRSYNFNNMGAEEETWQDMRKRVLQKLHRLFGGSDED 139 >At2g35210.1 68415.m04319 human Rev interacting-like family protein / hRIP family protein similar to ARFGAP1 protein GI:7211442 from [Homo sapiens]; contains InterPro accession IPR001164: Human Rev interacting-like protein (hRIP) Length = 395 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -2 Query: 421 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 257 E+++ ++F N ++ SS N + ++ E KSS K S SS F DGD Sbjct: 294 ETDEARKKFTNAKSISSAQYFGNDNNSADLEAKSSLKKFSGSSAISSADLFGDGD 348 >At2g31030.1 68415.m03783 oxysterol-binding family protein similar to SWH1 [Saccharomyces cerevisiae] GI:402658; contains Pfam profile PF01237: Oxysterol-binding protein Length = 489 Score = 27.1 bits (57), Expect = 8.3 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +3 Query: 219 FNLLRFGLVVSRASPSLKDLL 281 +NL RFG+ ++ +P LK++L Sbjct: 385 YNLTRFGITLNELTPDLKEML 405 >At1g76770.1 68414.m08934 heat shock protein-related contains similarity to 17.9 kDa heat-shock protein [Helianthus annuus] gi|11990130|emb|CAB55634 Length = 244 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = -2 Query: 454 KSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 275 K+ E E+ + E EN+EAE ++ V G+ R GK EE E K Sbjct: 154 KTEEKTEPEEEIKEETKPEEENEEAEEPQREEEEEVVEEGT-RDHEGKKEEEIEDKPRKK 212 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.1 bits (57), Expect = 8.3 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 10/87 (11%) Frame = -2 Query: 502 GTNKSSETKTGKRD--GSKSGVTV--EREKSESNKKSREFENKEAESSTYRDKNRSVNS- 338 GT+K E + + D G G+ + E + E + E E+KE E S + + Sbjct: 4515 GTDKKEEEEKEQDDVLGKNKGIEMSDEFDGKEYSVSEDEEEDKEDEGSEDEPLDNGIGDV 4574 Query: 337 GSERKSS-----GKDEEYSEQNSSNKS 272 GS+ + + KDEE E+N + K+ Sbjct: 4575 GSDAEKADEKPWNKDEEDEEENMNEKN 4601 >At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1) (FAS1) identical to FAS1 [Arabidopsis thaliana] GI:4887626 Length = 815 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/64 (25%), Positives = 30/64 (46%) Frame = -2 Query: 484 ETKTGKRDGSKSGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 305 E K +R K + E+E+ K + NKE E + R + + SE++ +++ Sbjct: 262 EKKRMERQVLKEKLQQEKEQKLLQKAIVDENNKEKEETESRKRIKKQQDESEKEQKRREK 321 Query: 304 EYSE 293 E +E Sbjct: 322 EQAE 325 >At1g63420.1 68414.m07172 expressed protein Length = 578 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -2 Query: 418 SNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 281 S KKS E + S++ ++NRS S S SG ++ +E N S Sbjct: 125 SEKKSPEETGSSVDCSSFLNQNRS-GSCSRTLQSGYNQNQTESNRS 169 >At1g22882.1 68414.m02857 expressed protein Length = 660 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = -2 Query: 430 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 272 +KSE N + + + + + +++ +G+ + D E+ EQN NK+ Sbjct: 154 KKSEINNTGTWNDTEGKDDNNFLKQSQLNKTGTGNDTESSDNEFLEQNQMNKT 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,377,426 Number of Sequences: 28952 Number of extensions: 171227 Number of successful extensions: 1669 Number of sequences better than 10.0: 168 Number of HSP's better than 10.0 without gapping: 1303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1622 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -