BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0502.Seq (349 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3||... 29 0.21 SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 25 2.5 >SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 465 Score = 29.1 bits (62), Expect = 0.21 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Frame = -2 Query: 204 VTLGTFV---LRINRNCK*SRYFNHQ*XVIIFVKKT-HVFIVRKFVGLIC 67 + LG F+ LR NRN +YF + V+ F +KT H +V F+ + C Sbjct: 236 ICLGCFIFILLRSNRNNPLGKYFTTEDEVLNFRRKTYHALVVFLFLPVCC 285 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 25.4 bits (53), Expect = 2.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 212 VHL*PWELLFFESTEIVNKVDISIIN 135 V+L W+L+F+ E + +SIIN Sbjct: 1323 VYLLVWDLIFYHFEETTYNIKLSIIN 1348 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,240,405 Number of Sequences: 5004 Number of extensions: 20729 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 104153322 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -