BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0500.Seq (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 29 0.083 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 5.4 Y09951-1|CAA71082.1| 107|Anopheles gambiae histone H2a protein. 22 9.5 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 28.7 bits (61), Expect = 0.083 Identities = 20/82 (24%), Positives = 35/82 (42%) Frame = -1 Query: 300 VYPELILEXIKSCKNSTTRQRLKLNRNYHILPIKSSLKAESYQA*KQLPKSLPVTNSGTP 121 + PEL ++ KSC S R + LP++SS + P P+ + Sbjct: 337 ITPELWMKNCKSCSISPVSDRSESVSPVPSLPVRSSPEPSPVLLRSPTPAKKPLISVAPA 396 Query: 120 DSPCSQSPKKTRMISRPS*KKT 55 S+S + + + +RPS K + Sbjct: 397 SKLLSKSLQPSTLPTRPSPKSS 418 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 22.6 bits (46), Expect = 5.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 88 CLLGRLAAGAVWG 126 C++G L G VWG Sbjct: 367 CIIGGLGFGVVWG 379 >Y09951-1|CAA71082.1| 107|Anopheles gambiae histone H2a protein. Length = 107 Score = 21.8 bits (44), Expect = 9.5 Identities = 10/28 (35%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -3 Query: 241 AIEAQQKLSHLTNKI-IAKGGVIPGLKA 161 AI ++ + L ++ IA+GGV+P ++A Sbjct: 71 AIRNDEEENKLLRRVTIAQGGVLPNIQA 98 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 390,558 Number of Sequences: 2352 Number of extensions: 6858 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -