SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0494.Seq
         (399 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   2e-04
SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.004
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              38   0.004
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.004
SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)                   38   0.004
SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)                  38   0.004
SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)                38   0.004
SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.004
SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.004
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)           38   0.004
SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.004
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)              38   0.004
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                       38   0.004
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.004
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                          38   0.004
SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.086
SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)                     33   0.086
SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.086
SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.086
SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.086
SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.086
SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.086
SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.)              33   0.086
SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.086
SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.086
SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.20 
SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01)                 32   0.20 
SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.35 
SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.35 
SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.35 
SB_24639| Best HMM Match : OEP (HMM E-Value=1.1)                       31   0.46 
SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.80 
SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.80 
SB_39984| Best HMM Match : RadC (HMM E-Value=2.2)                      30   0.80 
SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6)                    30   0.80 
SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1)                     30   0.80 
SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6)                    30   0.80 
SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6)                    30   0.80 
SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2)                    30   0.80 
SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1)                  30   0.80 
SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05)                   30   0.80 
SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6)                    30   0.80 
SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   0.80 
SB_44598| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   1.4  
SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09)          29   1.4  
SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   2.4  
SB_15801| Best HMM Match : eRF1_2 (HMM E-Value=4.8)                    28   2.4  
SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   4.3  
SB_54473| Best HMM Match : DLIC (HMM E-Value=0)                        27   4.3  
SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   4.3  
SB_44259| Best HMM Match : MORN (HMM E-Value=3.7)                      27   4.3  
SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05)                 27   4.3  
SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9)             27   4.3  
SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   4.3  
SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)                     27   5.6  
SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)               27   5.6  
SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)                    27   5.6  
SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)                    27   5.6  
SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)                    27   5.6  
SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)               27   5.6  
SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)                27   5.6  
SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)                      27   5.6  
SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8)                    27   5.6  
SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)               27   5.6  
SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)                    27   5.6  
SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)                    27   5.6  
SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0)               27   5.6  
SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)                 27   5.6  
SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)                 27   5.6  
SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)                   27   5.6  
SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)                    27   5.6  
SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016)                 27   5.6  
SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21)                27   5.6  
SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034)                 27   5.6  
SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016)                   27   5.6  
SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36)               27   5.6  
SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2)             27   5.6  
SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15)                 27   5.6  
SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31)              27   5.6  
SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076)                    27   5.6  
SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05)                     27   5.6  
SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29332| Best HMM Match : PAN (HMM E-Value=0.039)                     27   5.6  
SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4)                   27   5.6  
SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5)                      27   5.6  
SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13)                  27   5.6  
SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_26735| Best HMM Match : rve (HMM E-Value=0.00066)                   27   5.6  
SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2)                      27   5.6  
SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6)                   27   5.6  
SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9)           27   5.6  
SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_21918| Best HMM Match : STT3 (HMM E-Value=0)                        27   5.6  
SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32)                  27   5.6  
SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4)                       27   5.6  
SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9)                    27   5.6  
SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061)                  27   5.6  
SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4)              27   5.6  
SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_17455| Best HMM Match : Ank (HMM E-Value=2.2)                       27   5.6  
SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18)                 27   5.6  
SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19)                   27   5.6  
SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8)             27   5.6  
SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8)               27   5.6  
SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_14086| Best HMM Match : POR (HMM E-Value=7.7)                       27   5.6  
SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3)                      27   5.6  
SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8)                    27   5.6  
SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14)         27   5.6  
SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2)                    27   5.6  
SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2)                   27   5.6  
SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08)                27   5.6  
SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09)                 27   5.6  
SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.6  
SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2)                     27   5.6  
SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7679| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22)                    27   5.6  
SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7304| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1)                27   5.6  
SB_7027| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_6958| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_5084| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_4603| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_4586| Best HMM Match : DUF765 (HMM E-Value=7)                       27   5.6  
SB_4554| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_4385| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_4363| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_4332| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002)                     27   5.6  
SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2)                    27   5.6  
SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_3391| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06)                    27   5.6  
SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  
SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   5.6  

>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 41.5 bits (93), Expect = 2e-04
 Identities = 23/49 (46%), Positives = 26/49 (53%)
 Frame = -3

Query: 391 PVNCNTTHYRANWVPGPPXRXTVXISLISNSRPLFYTSLVKEKYALLRK 245
           PVNCNTTHYRANW         V  +L     P    S++ E Y LLRK
Sbjct: 68  PVNCNTTHYRANW-----SSTAVAAALELVDPPGCRNSMIYENYILLRK 111


>SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 408

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 12  PVNCNTTHYRANW 24


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 636 PVNCNTTHYRANW 648


>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 47  PVNCNTTHYRANW 59


>SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)
          Length = 257

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 9   PVNCNTTHYRANW 21


>SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)
          Length = 117

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 49  PVNCNTTHYRANW 61


>SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1907

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391  PVNCNTTHYRANW 353
            PVNCNTTHYRANW
Sbjct: 1887 PVNCNTTHYRANW 1899


>SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 47  PVNCNTTHYRANW 59


>SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 9   PVNCNTTHYRANW 21


>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
          Length = 768

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 41  PVNCNTTHYRANW 53


>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 90  PVNCNTTHYRANW 102


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 68  PVNCNTTHYRANW 80


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 79  PVNCNTTHYRANW 91


>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 55  PVNCNTTHYRANW 67


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score = 37.5 bits (83), Expect = 0.004
 Identities = 13/13 (100%), Positives = 13/13 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRANW 353
           PVNCNTTHYRANW
Sbjct: 79  PVNCNTTHYRANW 91


>SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 15/18 (83%), Positives = 15/18 (83%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLISNS 299
           VPGPP R TV ISLISNS
Sbjct: 20  VPGPPSRSTVSISLISNS 37



 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 237

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRAN 356
           PVNCNTTHYRAN
Sbjct: 86  PVNCNTTHYRAN 97



 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 116 QEFDIKLIDTVDLEGGP 132


>SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 15/18 (83%), Positives = 15/18 (83%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLISNS 299
           VPGPP R TV ISLISNS
Sbjct: 20  VPGPPSRSTVSISLISNS 37



 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 15/18 (83%), Positives = 15/18 (83%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLISNS 299
           VPGPP R TV ISLISNS
Sbjct: 20  VPGPPSRSTVSISLISNS 37



 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 15/18 (83%), Positives = 15/18 (83%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLISNS 299
           VPGPP R TV ISLISNS
Sbjct: 20  VPGPPSRSTVSISLISNS 37



 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 15/18 (83%), Positives = 15/18 (83%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLISNS 299
           VPGPP R TV ISLISNS
Sbjct: 20  VPGPPSRSTVSISLISNS 37



 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 73

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 12/12 (100%), Positives = 12/12 (100%)
 Frame = -3

Query: 391 PVNCNTTHYRAN 356
           PVNCNTTHYRAN
Sbjct: 29  PVNCNTTHYRAN 40


>SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 15/18 (83%), Positives = 15/18 (83%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLISNS 299
           VPGPP R TV ISLISNS
Sbjct: 20  VPGPPSRSTVSISLISNS 37



 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 15/18 (83%), Positives = 15/18 (83%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLISNS 299
           VPGPP R TV ISLISNS
Sbjct: 20  VPGPPSRSTVSISLISNS 37



 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 156

 Score = 33.1 bits (72), Expect = 0.086
 Identities = 15/18 (83%), Positives = 15/18 (83%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLISNS 299
           VPGPP R TV ISLISNS
Sbjct: 18  VPGPPSRSTVSISLISNS 35



 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 54  NSPYSESYYN 63


>SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 848

 Score = 31.9 bits (69), Expect = 0.20
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = -3

Query: 319 ISLISNSRPLFYTSLVKEKYALLRKHIRYSLPSP*EYRCLIQLNTTWSIPCSV 161
           + L   S+  +Y   VKEK      H+ +    P   RC I+LN  WS PC V
Sbjct: 733 LKLSHQSQKSYYDCWVKEKIFKKGDHVLWFDKKPRRGRC-IKLNRPWSGPCIV 784


>SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01)
          Length = 317

 Score = 31.9 bits (69), Expect = 0.20
 Identities = 14/18 (77%), Positives = 14/18 (77%)
 Frame = +3

Query: 306 DIKLIXTVXLXGGPGTQF 359
           DIKLI TV L GGPGT F
Sbjct: 297 DIKLIDTVDLEGGPGTSF 314


>SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 92

 Score = 31.1 bits (67), Expect = 0.35
 Identities = 14/20 (70%), Positives = 15/20 (75%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGPGTQ 356
           +EFDIKLI TV L GGP  Q
Sbjct: 67  QEFDIKLIDTVDLEGGPAYQ 86


>SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 31.1 bits (67), Expect = 0.35
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +3

Query: 243 CFRSKAYFSLTRLV*KSGREFDIKLIXTVXLXGGP 347
           CF +  Y+  T    KS ++ DIKLI TV L GGP
Sbjct: 59  CFNTIRYYGSTL---KSRQKTDIKLIDTVDLEGGP 90


>SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 31.1 bits (67), Expect = 0.35
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = +1

Query: 355 NSPYSESYYNXPA 393
           NSPYSESYYN PA
Sbjct: 24  NSPYSESYYNSPA 36


>SB_24639| Best HMM Match : OEP (HMM E-Value=1.1)
          Length = 197

 Score = 30.7 bits (66), Expect = 0.46
 Identities = 21/57 (36%), Positives = 29/57 (50%)
 Frame = +3

Query: 189 FSCIKHRYSYGDGKEYRICFRSKAYFSLTRLV*KSGREFDIKLIXTVXLXGGPGTQF 359
           +   K +Y     K Y++   +KA + L +   K  +   IKLI TV L GGPGT F
Sbjct: 143 YKLAKAKYKLAKAK-YKL---AKAKYKLAKAKYKLAKA-KIKLIDTVDLEGGPGTSF 194


>SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_39984| Best HMM Match : RadC (HMM E-Value=2.2)
          Length = 229

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 92

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1)
          Length = 142

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 141

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 127

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2)
          Length = 119

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1)
          Length = 142

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05)
          Length = 2200

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 15/24 (62%), Positives = 15/24 (62%)
 Frame = +3

Query: 288 KSGREFDIKLIXTVXLXGGPGTQF 359
           KS     IKLI TV L GGPGT F
Sbjct: 477 KSLSSAKIKLIDTVDLEGGPGTSF 500


>SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6)
          Length = 142

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 29.9 bits (64), Expect = 0.80
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +EFDIKLI TV L GGP
Sbjct: 21  QEFDIKLIDTVDLEGGP 37


>SB_44598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 62

 Score = 29.1 bits (62), Expect = 1.4
 Identities = 18/28 (64%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = +3

Query: 267 SLTRLV*KSGREF-DIKLIXTVXLXGGP 347
           +L  LV KS R F DIKLI TV L GGP
Sbjct: 34  TLQALVQKSKRCFTDIKLIDTVDLEGGP 61


>SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09)
          Length = 1248

 Score = 29.1 bits (62), Expect = 1.4
 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = -3

Query: 370  HYRANWVPGPPXRXTVXISLI---SNSRPLFYTSLVKEKYALLRKHIRYSLPS 221
            H     VPGPP R TV ISLI   + SR L    +  E    LR ++  S  S
Sbjct: 1074 HREQKLVPGPPSRSTVSISLILDCNASRSLAGVKMTNEPPKGLRANLLRSYHS 1126


>SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 198

 Score = 28.3 bits (60), Expect = 2.4
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = +3

Query: 249 RSKAYFSLTRLV*KSGREFDIKLIXTVXLXGGP 347
           R   Y S  + + + G  + IKLI TV L GGP
Sbjct: 61  RGTLYISTVQGIEQRGTSYIIKLIDTVDLEGGP 93


>SB_15801| Best HMM Match : eRF1_2 (HMM E-Value=4.8)
          Length = 562

 Score = 28.3 bits (60), Expect = 2.4
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +3

Query: 201 KHRYSYGDGKEYRICFRSKAYFSLTRLV 284
           +H +S GD ++  IC  SKAY  L R V
Sbjct: 432 EHEFSLGDAEKEFICATSKAYEELIRNV 459


>SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 105

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 11/17 (64%), Positives = 14/17 (82%)
 Frame = +3

Query: 297 REFDIKLIXTVXLXGGP 347
           +++DIKLI TV L GGP
Sbjct: 34  KKYDIKLIDTVDLEGGP 50


>SB_54473| Best HMM Match : DLIC (HMM E-Value=0)
          Length = 1401

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%)
 Frame = +1

Query: 250 EARHIFP*PGLCKRAVANXXXXXXXXXTXRGGP--VPNSPYSESYYN 384
           E + +FP P + +R+  N           R  P    NSPYSESYYN
Sbjct: 368 EEQSVFPVPRVDRRS--NSCSPGDPLVLERPPPRWSSNSPYSESYYN 412


>SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 236

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 3/46 (6%)
 Frame = +1

Query: 256 RHIFP*PGLCKRAV-ANXXXXXXXXXTXRGGP--VPNSPYSESYYN 384
           RH+    G  KR+V +N           R  P    NSPYSESYYN
Sbjct: 98  RHVLRSWGRLKRSVESNSCSPGDPLVLERPPPRWSSNSPYSESYYN 143


>SB_44259| Best HMM Match : MORN (HMM E-Value=3.7)
          Length = 718

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%)
 Frame = +1

Query: 286 KRAVANXXXXXXXXXTXRGGP--VPNSPYSESYYN 384
           KRA +N           R  P    NSPYSESYYN
Sbjct: 317 KRAYSNTYIKRAYSVLERPPPRWSSNSPYSESYYN 351


>SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05)
          Length = 680

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 3/40 (7%)
 Frame = +1

Query: 274 PGLCKRA-VANXXXXXXXXXTXRGGP--VPNSPYSESYYN 384
           P +CK   V+N           R  P    NSPYSESYYN
Sbjct: 206 PEICKTVNVSNSCSPGDPLVLERPPPRWSSNSPYSESYYN 245


>SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9)
          Length = 350

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 12/15 (80%), Positives = 12/15 (80%)
 Frame = -3

Query: 352 VPGPPXRXTVXISLI 308
           VPGPP R TV ISLI
Sbjct: 6   VPGPPSRSTVSISLI 20


>SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 132

 Score = 27.5 bits (58), Expect = 4.3
 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 2/38 (5%)
 Frame = +1

Query: 277 GLCKRAVANXXXXXXXXXTXRGGP--VPNSPYSESYYN 384
           GL   AV+N           R  P    NSPYSESYYN
Sbjct: 2   GLFCEAVSNSCSPGDPLVLERPPPRWSSNSPYSESYYN 39


>SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 33  NSPYSESYYN 42


>SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 31  NSPYSESYYN 40


>SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 47  NSPYSESYYN 56


>SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 24  NSPYSESYYN 33


>SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 39  NSPYSESYYN 48


>SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 48  NSPYSESYYN 57


>SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 29  NSPYSESYYN 38


>SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12)
          Length = 297

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 205 NSPYSESYYN 214


>SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 202

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 100 NSPYSESYYN 109


>SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 36  NSPYSESYYN 45


>SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69)
          Length = 472

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 370 NSPYSESYYN 379


>SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 28  NSPYSESYYN 37


>SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1)
          Length = 129

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 27  NSPYSESYYN 36


>SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 34  NSPYSESYYN 43


>SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 431

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 329 NSPYSESYYN 338


>SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 69  NSPYSESYYN 78


>SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 39  NSPYSESYYN 48


>SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 150

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 48  NSPYSESYYN 57


>SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 32  NSPYSESYYN 41


>SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 225

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 123 NSPYSESYYN 132


>SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 52  NSPYSESYYN 61


>SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 28  NSPYSESYYN 37


>SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 245 NSPYSESYYN 254


>SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 25  NSPYSESYYN 34


>SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 205

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 103 NSPYSESYYN 112


>SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 23  NSPYSESYYN 32


>SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 487

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 385 NSPYSESYYN 394


>SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 269

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 108 NSPYSESYYN 117


>SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 45  NSPYSESYYN 54


>SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6)
          Length = 137

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 35  NSPYSESYYN 44


>SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 43  NSPYSESYYN 52


>SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 154

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 52  NSPYSESYYN 61


>SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 300

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 174 NSPYSESYYN 183


>SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 23  NSPYSESYYN 32


>SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 29  NSPYSESYYN 38


>SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 43  NSPYSESYYN 52


>SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6)
          Length = 142

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 40  NSPYSESYYN 49


>SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 24  NSPYSESYYN 33


>SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 38  NSPYSESYYN 47


>SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 28  NSPYSESYYN 37


>SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 110

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 73  NSPYSESYYN 82


>SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29)
          Length = 473

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 329 NSPYSESYYN 338


>SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 75  NSPYSESYYN 84


>SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 25  NSPYSESYYN 34


>SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20)
          Length = 385

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 283 NSPYSESYYN 292


>SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 46  NSPYSESYYN 55


>SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 857

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 400 NSPYSESYYN 409


>SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 40  NSPYSESYYN 49


>SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 32  NSPYSESYYN 41


>SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 184

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 82  NSPYSESYYN 91


>SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 302

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 200 NSPYSESYYN 209


>SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 32  NSPYSESYYN 41


>SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 133

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 32  NSPYSESYYN 41


>SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 40  NSPYSESYYN 49


>SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 34  NSPYSESYYN 43


>SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 24  NSPYSESYYN 33


>SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1)
          Length = 286

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 184 NSPYSESYYN 193


>SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8)
          Length = 143

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 41  NSPYSESYYN 50


>SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 42  NSPYSESYYN 51


>SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 237

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 75  NSPYSESYYN 84


>SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 38  NSPYSESYYN 47


>SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4)
          Length = 325

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 176 NSPYSESYYN 185


>SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 39  NSPYSESYYN 48


>SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 167

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 65  NSPYSESYYN 74


>SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 187

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 85  NSPYSESYYN 94


>SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 103

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 29  NSPYSESYYN 38


>SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 140

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 38  NSPYSESYYN 47


>SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 754

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 652 NSPYSESYYN 661


>SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5)
          Length = 139

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 37  NSPYSESYYN 46


>SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 26  NSPYSESYYN 35


>SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 25  NSPYSESYYN 34


>SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4)
          Length = 134

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 32  NSPYSESYYN 41


>SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 171

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 69  NSPYSESYYN 78


>SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 121

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 19  NSPYSESYYN 28


>SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 34  NSPYSESYYN 43


>SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0)
          Length = 496

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 64  NSPYSESYYN 73


>SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023)
          Length = 1016

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 914 NSPYSESYYN 923


>SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 35  NSPYSESYYN 44


>SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 46  NSPYSESYYN 55


>SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 136

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 35  NSPYSESYYN 44


>SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56)
          Length = 166

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 64  NSPYSESYYN 73


>SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 217

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 115 NSPYSESYYN 124


>SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 188

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 86  NSPYSESYYN 95


>SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 145

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 43  NSPYSESYYN 52


>SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 195

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 93  NSPYSESYYN 102


>SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 36  NSPYSESYYN 45


>SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016)
          Length = 999

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 897 NSPYSESYYN 906


>SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8)
          Length = 130

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 28  NSPYSESYYN 37


>SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 134

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 32  NSPYSESYYN 41


>SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 84  NSPYSESYYN 93


>SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 70  NSPYSESYYN 79


>SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 128

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 26  NSPYSESYYN 35


>SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 45  NSPYSESYYN 54


>SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 39  NSPYSESYYN 48


>SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 41  NSPYSESYYN 50


>SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 186

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 85  NSPYSESYYN 94


>SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 166

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 64  NSPYSESYYN 73


>SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 149

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 47  NSPYSESYYN 56


>SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 162

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 60  NSPYSESYYN 69


>SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 138

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 36  NSPYSESYYN 45


>SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 144

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 42  NSPYSESYYN 51


>SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 45  NSPYSESYYN 54


>SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 203

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 101 NSPYSESYYN 110


>SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 152

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 51  NSPYSESYYN 60


>SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 164

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 62  NSPYSESYYN 71


>SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 126

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 24  NSPYSESYYN 33


>SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 916

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 814 NSPYSESYYN 823


>SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 163

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 61  NSPYSESYYN 70


>SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 148

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 46  NSPYSESYYN 55


>SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016)
          Length = 872

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 770 NSPYSESYYN 779


>SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 137

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 36  NSPYSESYYN 45


>SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21)
          Length = 372

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 60  NSPYSESYYN 69


>SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034)
          Length = 265

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 163 NSPYSESYYN 172


>SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016)
          Length = 606

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 504 NSPYSESYYN 513


>SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 125

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 23  NSPYSESYYN 32


>SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 56  NSPYSESYYN 65


>SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36)
          Length = 1290

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 31  NSPYSESYYN 40


>SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 102 NSPYSESYYN 111


>SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 159

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 57  NSPYSESYYN 66


>SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 184

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 82  NSPYSESYYN 91


>SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 147

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 45  NSPYSESYYN 54


>SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2)
          Length = 352

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 174 NSPYSESYYN 183


>SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 25  NSPYSESYYN 34


>SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 127

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 25  NSPYSESYYN 34


>SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 177

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 75  NSPYSESYYN 84


>SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 130

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 28  NSPYSESYYN 37


>SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


>SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 120

 Score = 27.1 bits (57), Expect = 5.6
 Identities = 10/10 (100%), Positives = 10/10 (100%)
 Frame = +1

Query: 355 NSPYSESYYN 384
           NSPYSESYYN
Sbjct: 18  NSPYSESYYN 27


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,228,920
Number of Sequences: 59808
Number of extensions: 199727
Number of successful extensions: 2135
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 2102
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2134
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 703143849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -