BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0493.Seq (398 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 27 1.1 SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual 26 2.5 SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 25 3.3 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 24 7.6 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 27.1 bits (57), Expect = 1.1 Identities = 16/60 (26%), Positives = 34/60 (56%), Gaps = 9/60 (15%) Frame = -2 Query: 196 YXXGFQN-SEVMINRDNWGHSYCDVRGEILG------SSQD--EHQRKHLPKVFSSIKNE 44 Y G+ N + ++++ WGHS+ +V E+L +QD E ++K+L ++ +S + + Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQ 201 >SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 978 Score = 25.8 bits (54), Expect = 2.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 151 NWGHSYCDVRGEILGSSQDEHQRKHLPKVFSSIKNE 44 NW + ++G I SSQ E +L KV SI +E Sbjct: 123 NWNDFFASLQGVIAASSQSEFSNFYL-KVLLSIGDE 157 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 25.4 bits (53), Expect = 3.3 Identities = 13/56 (23%), Positives = 23/56 (41%) Frame = +2 Query: 119 TSNVAIRMPPVIPINHYLGVLKTXXIEPRSYSIIPCXKYSSSIXSRFEHSNLXKVK 286 T +++ +P + G+ +P I C KY S+ S HS L ++ Sbjct: 208 TRKFLVKLAKALPDAKFFGIFDW---DPHGLCIYSCFKYGSNAYSHEPHSQLRNLQ 260 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 24.2 bits (50), Expect = 7.6 Identities = 6/20 (30%), Positives = 17/20 (85%) Frame = +2 Query: 101 RRSKNFTSNVAIRMPPVIPI 160 + SK++ +N ++++PP++P+ Sbjct: 558 KTSKSYKTNDSLKVPPLVPL 577 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,373,486 Number of Sequences: 5004 Number of extensions: 22060 Number of successful extensions: 41 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -