BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0493.Seq (398 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0148 - 1337494-1338057 27 7.2 01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177,804... 26 9.5 >01_01_0148 - 1337494-1338057 Length = 187 Score = 26.6 bits (56), Expect = 7.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 57 DENTFGKCFR*CSSCDDP 110 DE G+CFR C +C DP Sbjct: 72 DELEPGQCFRQCEACRDP 89 >01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177, 8048455-8048540,8048698-8048983,8049063-8049205, 8049308-8049508,8049626-8049754,8050463-8050738, 8050823-8051098,8051364-8052364,8052452-8052634, 8052865-8052937,8053205-8053313,8053622-8053785 Length = 1093 Score = 26.2 bits (55), Expect = 9.5 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 Query: 114 FLDRRKTNISESICQRCFHQSRTKVRGSKAIRY 16 +++ N SIC RC H S K + K Y Sbjct: 561 YVEVENGNDKSSICGRCHHLSSAKAKYQKRFSY 593 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,709,993 Number of Sequences: 37544 Number of extensions: 135742 Number of successful extensions: 275 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 275 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -