BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0489.Seq (399 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 4.5 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 20 7.8 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 4.5 Identities = 19/73 (26%), Positives = 31/73 (42%), Gaps = 4/73 (5%) Frame = -1 Query: 252 SCRKGHQGQEVARAVNS-TIFXTTAILHSPK---GVSKEKRATNSFLFYIFYKACNVTLF 85 S R+G Q + + + + F T LHS KEK ++ Y FYK + Sbjct: 384 SRREGKQLNPLNKGTEADSSFVTLPQLHSLDEWDDTLKEKADFQYYVSYDFYKMNHPVYH 443 Query: 84 YNLYKVIHNISET 46 + + HN++ T Sbjct: 444 KDPHYGFHNVTNT 456 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 20.2 bits (40), Expect = 7.8 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 367 FQEFPPLGRXAVRDMR 320 + FPP R +RD R Sbjct: 81 YPRFPPYDRMDIRDRR 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,427 Number of Sequences: 336 Number of extensions: 1356 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -