BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0489.Seq (399 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 83 1e-18 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 78 3e-17 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 0.97 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 23 1.3 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 23 1.3 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 23 1.3 AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 21 6.9 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 83.0 bits (196), Expect = 1e-18 Identities = 40/49 (81%), Positives = 42/49 (85%) Frame = -3 Query: 397 VPSKPLCVEXFQEFPPLGRXAVRDMRQTXAVGVIKAVNFKEAGGGKVTK 251 VPSKP+C E FQEFPPLGR AVRDMRQT AVGVIKAV FK+A GKVTK Sbjct: 405 VPSKPMCAEAFQEFPPLGRFAVRDMRQTVAVGVIKAVTFKDA-AGKVTK 452 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 78.2 bits (184), Expect = 3e-17 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -3 Query: 394 PSKPLCVEXFQEFPPLGRXAVRDMRQTXAVGVIKAVNFKEAGGGKVTK 251 P+KP+CVE FQEFPPLGR AVRDMRQT AVGVIK+V FK+ GKVTK Sbjct: 406 PTKPMCVEAFQEFPPLGRFAVRDMRQTVAVGVIKSVTFKDT-QGKVTK 452 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 0.97 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 136 CSPFFLRNTFR*MKYRSCXKN 198 C FF R+ + ++YR C KN Sbjct: 87 CKGFFRRSIQQKIQYRPCTKN 107 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 175 KYRSCXKNCAVNSSSYFLPLVAFS 246 K+ C KN A SSYF+ + F+ Sbjct: 94 KFYDCLKNSADTISSYFVGKMYFN 117 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 175 KYRSCXKNCAVNSSSYFLPLVAFS 246 K+ C KN A SSYF+ + F+ Sbjct: 99 KFYDCLKNSADTISSYFVGKMYFN 122 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 23.0 bits (47), Expect = 1.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 175 KYRSCXKNCAVNSSSYFLPLVAFS 246 K+ C KN A SSYF+ + F+ Sbjct: 99 KFYDCLKNSADTISSYFVGKMYFN 122 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 20.6 bits (41), Expect = 6.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 145 FFLRNTFR*MKYRSCXKN 198 FF R+ + ++YR C KN Sbjct: 41 FFRRSIQQKIQYRPCTKN 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,321 Number of Sequences: 438 Number of extensions: 1502 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9885360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -