BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0487.Seq (469 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 25 1.7 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 22 9.3 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.6 bits (51), Expect = 1.7 Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -1 Query: 97 SNIEKAIRKAMNKNEAED---DQSRLDEDRRRYKK 2 S E ++ +K EAE D+++++ED+R Y++ Sbjct: 121 STWENTVQNIRDKKEAERLRRDKAKVEEDQRHYRE 155 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 22.2 bits (45), Expect = 9.3 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 163 DLCWILISFSYLILNNIDPEFQGFL*I-FLQAR*IFIDNINI 285 D+ + LIS +L L+N E+Q F+ + +Q R ++ NI Sbjct: 77 DIFFPLISLVFLDLSNTRLEYQAFIALRSVQRRVQYVSYCNI 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 282,717 Number of Sequences: 2352 Number of extensions: 4443 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -