Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0486.Seq
         (399 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_55238| Best HMM Match : Serpin (HMM E-Value=0)                      33   0.11 

>SB_55238| Best HMM Match : Serpin (HMM E-Value=0)
          Length = 345

 Score = 32.7 bits (71), Expect = 0.11
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 5/61 (8%)
 Frame = -1

Query: 399 MFDPQSNDFEXXXLNSDPENVSAAIQKAQIIVDETGTXXXVATAVV-----GAKRHPQLF 235
           MFD  + DF    L  +   VSA + KA + V+E GT    ATA +        R P +F
Sbjct: 257 MFDQAAADFTGISLPPEHLFVSAVLHKAFVEVNEEGTEAAAATAAIMMMRCAIMREPLVF 316

Query: 234 R 232
           R
Sbjct: 317 R 317


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,312,482
Number of Sequences: 59808
Number of extensions: 111043
Number of successful extensions: 153
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 134
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 153
length of database: 16,821,457
effective HSP length: 75
effective length of database: 12,335,857
effective search space used: 703143849
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)