BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0486.Seq (399 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55238| Best HMM Match : Serpin (HMM E-Value=0) 33 0.11 >SB_55238| Best HMM Match : Serpin (HMM E-Value=0) Length = 345 Score = 32.7 bits (71), Expect = 0.11 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = -1 Query: 399 MFDPQSNDFEXXXLNSDPENVSAAIQKAQIIVDETGTXXXVATAVV-----GAKRHPQLF 235 MFD + DF L + VSA + KA + V+E GT ATA + R P +F Sbjct: 257 MFDQAAADFTGISLPPEHLFVSAVLHKAFVEVNEEGTEAAAATAAIMMMRCAIMREPLVF 316 Query: 234 R 232 R Sbjct: 317 R 317 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,312,482 Number of Sequences: 59808 Number of extensions: 111043 Number of successful extensions: 153 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -