BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0485.Seq (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 28 0.054 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 26 0.16 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 25 0.50 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 0.66 DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 21 8.1 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 27.9 bits (59), Expect = 0.054 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +3 Query: 48 FGSQPMHRRR*RIYYWSSVHCTPRLYRNSCVPSHCSLTDSYPYRSKI-QLLYFQIHDFSC 224 FG+ ++ R YYW +++ T + SC + + + P++ + +LY I D C Sbjct: 143 FGATKVYNSMKREYYWPNMYRTIKKRLRSCDLCQKTKSSNRPHQGPLTPILYDHIGDLVC 202 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 26.2 bits (55), Expect = 0.16 Identities = 12/60 (20%), Positives = 29/60 (48%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 EREK S+ ++ E + +E +DK + + G + K E+ ++ + + + + + Sbjct: 218 EREKELSDDEAEEEKKEEEGEDKDKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDE 277 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 24.6 bits (51), Expect = 0.50 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 232 GFFPFDCEPLFEPSRLPVFVSDDLLVPVS 318 GFFP D +F ++L +F +++ VS Sbjct: 699 GFFPIDYSLVFSETKLLLFKITSVMIAVS 727 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 0.66 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 171 DKNRSVNSGSERKSSGKDEEYSEQNSSNK-SFNDGDASADYQTKSKKVE 28 D+ RS + +E KSS D SE+ S S N + AD+ KVE Sbjct: 29 DEKRSSENLTEEKSSLIDLTESEEKSGGSYSSNKNVSRADHSPVFGKVE 77 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 20.6 bits (41), Expect = 8.1 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 86 NPLTTAMHRLTTKPNLRRLKRILPEIKK 3 N M R P+ LKR+LP+ K Sbjct: 40 NYFNCIMDRGACTPDADELKRVLPDALK 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,742 Number of Sequences: 336 Number of extensions: 1267 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -