BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0485.Seq (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28770.1 68416.m03591 expressed protein 43 1e-04 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 40 0.001 At5g61150.2 68418.m07672 leo1-like family protein weak similarit... 38 0.004 At2g22795.1 68415.m02704 expressed protein 38 0.004 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 38 0.004 At3g29075.1 68416.m03637 glycine-rich protein 38 0.005 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 38 0.005 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 37 0.007 At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa... 37 0.007 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 37 0.007 At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp... 36 0.015 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 36 0.020 At1g56660.1 68414.m06516 expressed protein 35 0.026 At5g53800.1 68418.m06685 expressed protein 35 0.035 At5g61150.1 68418.m07671 leo1-like family protein weak similarit... 34 0.046 At5g58880.1 68418.m07377 hypothetical protein 34 0.046 At2g27470.1 68415.m03320 CCAAT-box binding transcription factor ... 34 0.046 At4g15030.1 68417.m02309 expressed protein 34 0.061 At3g59800.1 68416.m06673 expressed protein 34 0.061 At1g78110.1 68414.m09103 expressed protein 34 0.061 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 33 0.081 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 33 0.081 At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family ... 33 0.081 At5g60030.1 68418.m07527 expressed protein 33 0.11 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 33 0.11 At5g53930.1 68418.m06710 expressed protein 33 0.11 At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein ... 33 0.11 At5g60530.1 68418.m07590 late embryogenesis abundant protein-rel... 33 0.14 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 33 0.14 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 33 0.14 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 33 0.14 At2g46900.1 68415.m05857 expressed protein contains Pfam profile... 33 0.14 At5g16680.1 68418.m01951 PHD finger family protein contains Pfam... 32 0.19 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 32 0.19 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 32 0.19 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 32 0.19 At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyc... 32 0.25 At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyc... 32 0.25 At2g34300.1 68415.m04196 dehydration-responsive protein-related ... 32 0.25 At5g12230.1 68418.m01435 expressed protein 31 0.33 At4g35940.1 68417.m05113 expressed protein 31 0.33 At4g33740.2 68417.m04791 expressed protein 31 0.33 At4g33740.1 68417.m04790 expressed protein 31 0.33 At3g60110.1 68416.m06712 DNA-binding bromodomain-containing prot... 31 0.33 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 31 0.33 At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing prote... 31 0.43 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 31 0.43 At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr... 31 0.43 At1g03530.1 68414.m00334 expressed protein similar to hypothetic... 31 0.43 At5g56360.1 68418.m07034 calmodulin-binding protein similar to a... 31 0.57 At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative 31 0.57 At5g48610.1 68418.m06012 expressed protein ; expression supporte... 31 0.57 At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-co... 31 0.57 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 31 0.57 At1g65090.1 68414.m07379 expressed protein 31 0.57 At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacu... 30 0.75 At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacu... 30 0.75 At3g48120.1 68416.m05248 expressed protein 30 0.75 At2g44430.1 68415.m05525 DNA-binding bromodomain-containing prot... 30 0.75 At1g74830.1 68414.m08670 expressed protein contains Pfam profile... 30 0.75 At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 30 0.75 At1g69070.1 68414.m07903 expressed protein 30 0.75 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 30 0.75 At5g66950.1 68418.m08440 expressed protein 30 1.00 At5g62750.1 68418.m07877 expressed protein predicted proteins, C... 30 1.00 At5g53440.1 68418.m06641 expressed protein 30 1.00 At5g47690.1 68418.m05887 expressed protein 30 1.00 At5g16500.1 68418.m01928 protein kinase family protein contains ... 30 1.00 At4g02720.1 68417.m00368 expressed protein temporary automated f... 30 1.00 At3g59990.2 68416.m06698 methionyl aminopeptidase, putative / me... 30 1.00 At3g59990.1 68416.m06697 methionyl aminopeptidase, putative / me... 30 1.00 At4g24590.1 68417.m03523 expressed protein 29 1.3 At4g00990.1 68417.m00133 transcription factor jumonji (jmjC) dom... 29 1.3 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 29 1.3 At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein ... 29 1.3 At2g12875.1 68415.m01402 hypothetical protein 29 1.3 At1g76770.1 68414.m08934 heat shock protein-related contains sim... 29 1.3 At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1)... 29 1.3 At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related simil... 29 1.3 At5g64030.1 68418.m08039 dehydration-responsive protein-related ... 29 1.7 At4g25880.2 68417.m03722 pumilio/Puf RNA-binding domain-containi... 29 1.7 At4g25880.1 68417.m03721 pumilio/Puf RNA-binding domain-containi... 29 1.7 At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calr... 29 1.7 At1g29470.1 68414.m03605 dehydration-responsive protein-related ... 29 1.7 At1g08600.1 68414.m00953 SNF2 domain-containing protein / helica... 29 1.7 At5g64910.1 68418.m08165 expressed protein ; expression support... 29 2.3 At5g38840.1 68418.m04698 forkhead-associated domain-containing p... 29 2.3 At3g62620.1 68416.m07034 sucrose-phosphatase-related contains we... 29 2.3 At3g58050.1 68416.m06471 expressed protein 29 2.3 At2g30060.1 68415.m03656 Ran-binding protein 1b (RanBP1b) nearly... 29 2.3 At2g25190.1 68415.m03012 expressed protein 29 2.3 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 29 2.3 At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) fa... 29 2.3 At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:100... 29 2.3 At1g01440.1 68414.m00059 extra-large G-protein-related weak simi... 29 2.3 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 28 3.0 At5g65490.1 68418.m08236 expressed protein similar to unknown pr... 28 3.0 At5g51410.2 68418.m06374 LUC7 N_terminus domain-containing prote... 28 3.0 At5g51410.1 68418.m06373 LUC7 N_terminus domain-containing prote... 28 3.0 At5g44690.1 68418.m05476 hypothetical protein 28 3.0 At5g10660.1 68418.m01234 calmodulin-binding protein-related cont... 28 3.0 At4g30935.1 68417.m04392 WRKY family transcription factor contai... 28 3.0 At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptid... 28 3.0 At4g24580.1 68417.m03522 pleckstrin homology (PH) domain-contain... 28 3.0 At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related conta... 28 3.0 At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related conta... 28 3.0 At3g27700.2 68416.m03459 RNA recognition motif (RRM)-containing ... 28 3.0 At3g27700.1 68416.m03458 RNA recognition motif (RRM)-containing ... 28 3.0 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 3.0 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 3.0 At1g69220.2 68414.m07926 serine/threonine protein kinase, putati... 28 3.0 At1g69220.1 68414.m07925 serine/threonine protein kinase, putati... 28 3.0 At1g32150.1 68414.m03955 bZIP transcription factor family protei... 28 3.0 At1g21390.1 68414.m02676 expressed protein 28 3.0 At1g17820.1 68414.m02206 expressed protein 28 3.0 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 28 3.0 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 28 4.0 At3g18810.1 68416.m02389 protein kinase family protein contains ... 28 4.0 At2g44200.1 68415.m05500 expressed protein 28 4.0 At2g43160.3 68415.m05361 epsin N-terminal homology (ENTH) domain... 28 4.0 At2g43160.2 68415.m05360 epsin N-terminal homology (ENTH) domain... 28 4.0 At2g43160.1 68415.m05359 epsin N-terminal homology (ENTH) domain... 28 4.0 At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 d... 28 4.0 At1g56110.1 68414.m06443 nucleolar protein Nop56, putative simil... 28 4.0 At1g19990.1 68414.m02504 expressed protein ; expression supporte... 28 4.0 At5g49430.1 68418.m06116 transducin family protein / WD-40 repea... 27 5.3 At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)... 27 5.3 At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)... 27 5.3 At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)... 27 5.3 At4g02110.1 68417.m00282 BRCT domain-containing protein contains... 27 5.3 At1g26680.1 68414.m03250 transcriptional factor B3 family protei... 27 5.3 At5g59730.1 68418.m07487 exocyst subunit EXO70 family protein le... 27 7.0 At5g59610.1 68418.m07469 DNAJ heat shock N-terminal domain-conta... 27 7.0 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 27 7.0 At5g37010.1 68418.m04438 expressed protein 27 7.0 At5g23420.1 68418.m02747 high mobility group (HMG1/2) family pro... 27 7.0 At5g22470.1 68418.m02621 poly (ADP-ribose) polymerase family pro... 27 7.0 At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim... 27 7.0 At4g37210.2 68417.m05267 tetratricopeptide repeat (TPR)-containi... 27 7.0 At4g37210.1 68417.m05268 tetratricopeptide repeat (TPR)-containi... 27 7.0 At4g34400.1 68417.m04886 transcriptional factor B3 family protei... 27 7.0 At3g11590.1 68416.m01416 expressed protein 27 7.0 At3g10800.1 68416.m01300 bZIP transcription factor family protei... 27 7.0 At2g40650.1 68415.m05016 pre-mRNA splicing factor PRP38 family p... 27 7.0 At2g35210.1 68415.m04319 human Rev interacting-like family prote... 27 7.0 At1g66050.1 68414.m07497 zinc finger (C3HC4-type RING finger) fa... 27 7.0 At1g63420.1 68414.m07172 expressed protein 27 7.0 At1g22882.1 68414.m02857 expressed protein 27 7.0 At1g17665.1 68414.m02187 expressed protein 27 7.0 At5g57370.1 68418.m07168 expressed protein low similarity to nuc... 27 9.3 At5g47680.1 68418.m05886 expressed protein contains Pfam profile... 27 9.3 At5g26210.1 68418.m03119 PHD finger family protein contains Pfam... 27 9.3 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 27 9.3 At5g17580.1 68418.m02062 phototropic-responsive NPH3 family prot... 27 9.3 At4g40020.1 68417.m05666 hypothetical protein 27 9.3 At4g14310.2 68417.m02205 peroxisomal membrane protein-related co... 27 9.3 At4g14310.1 68417.m02204 peroxisomal membrane protein-related co... 27 9.3 At4g04400.1 68417.m00634 hypothetical protein contains Pfam prof... 27 9.3 At3g26910.1 68416.m03367 hydroxyproline-rich glycoprotein family... 27 9.3 At2g38370.1 68415.m04714 expressed protein 27 9.3 At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50... 27 9.3 At2g04870.1 68415.m00503 hypothetical protein 27 9.3 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 27 9.3 At1g61690.1 68414.m06958 tetratricopeptide repeat (TPR)-containi... 27 9.3 At1g24120.1 68414.m03043 DNAJ heat shock protein, putative simil... 27 9.3 At1g05440.1 68414.m00552 expressed protein ; expression supporte... 27 9.3 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 42.7 bits (96), Expect = 1e-04 Identities = 28/84 (33%), Positives = 40/84 (47%), Gaps = 2/84 (2%) Frame = -2 Query: 246 EREKSESNK-KSREFENKEA-ESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 73 E KSE++K K +NKE ES KNR E+KS K+E E+ S + Sbjct: 980 ETTKSENSKLKEENKDNKEKKESEDSASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKRE 1039 Query: 72 GDASADYQTKSKKVEKNSARDKKK 1 S + ++K +K E + KKK Sbjct: 1040 EKDSEERKSKKEKEESRDLKAKKK 1063 Score = 41.1 bits (92), Expect = 4e-04 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 1/89 (1%) Frame = -2 Query: 264 EERLTVEREKSE-SNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 88 E+ + REK E KKS+ E + E +DK R ERKS + EE + + Sbjct: 1003 EDSASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKEKEESRDLKAKK 1062 Query: 87 KSFNDGDASADYQTKSKKVEKNSARDKKK 1 K + KSKK E + K Sbjct: 1063 KEEETKEKKESENHKSKKKEDKKEHEDNK 1091 Score = 35.9 bits (79), Expect = 0.015 Identities = 19/87 (21%), Positives = 43/87 (49%), Gaps = 2/87 (2%) Frame = -2 Query: 258 RLTVEREKSESNKKSREFENKEAESSTYRDK-NRSVNSGSERKSSGKDEEYSEQNSSN-K 85 +L E + ++ K+S + +K E Y +K +++ + K +D++ E++S K Sbjct: 988 KLKEENKDNKEKKESEDSASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERK 1047 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKK 4 S + + S D + K K+ E ++ + Sbjct: 1048 SKKEKEESRDLKAKKKEEETKEKKESE 1074 Score = 35.9 bits (79), Expect = 0.015 Identities = 20/97 (20%), Positives = 46/97 (47%) Frame = -2 Query: 291 NEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 112 +ED ++ EE +++ ES + +E + K+ E ++ N+ +E+K S + Sbjct: 1087 HEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLEDQNSNKKKEDKNEKKKSQHVKL 1146 Query: 111 YSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 +++ + + + S + +S K +KN K+K Sbjct: 1147 VKKESDKKEKKENEEKSETKEIESSKSQKNEVDKKEK 1183 Score = 34.7 bits (76), Expect = 0.035 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 8/96 (8%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTY-------RDKNRSVNSGSERKSSGK-DEEY 109 +E T E+++SE++K ++ + KE E + ++K + S S +K K D E Sbjct: 1063 KEEETKEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEK 1122 Query: 108 SEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 E +SNK D + Q K V+K S + +KK Sbjct: 1123 LEDQNSNKKKEDKNEKKKSQ-HVKLVKKESDKKEKK 1157 Score = 32.7 bits (71), Expect = 0.14 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 5/87 (5%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSS-----GKDEEYSEQNSSNKS 82 E +K E + + E KE ESS + + V+ E+KSS K++E E Sbjct: 1150 ESDKKEKKENEEKSETKEIESS--KSQKNEVDK-KEKKSSKDQQKKKEKEMKESEEKKLK 1206 Query: 81 FNDGDASADYQTKSKKVEKNSARDKKK 1 N+ D + K +K + ++K K Sbjct: 1207 KNEEDRKKQTSVEENKKQKETKKEKNK 1233 Score = 30.3 bits (65), Expect = 0.75 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRD--KNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 73 E+++S+ K +NK+ S+ RD K RS E K KD Y + K+ N Sbjct: 789 EKKESKDAKSVETKDNKKLSSTENRDEAKERSGEDNKEDKEESKD--YQSVEAKEKNENG 846 Query: 72 G-DASADYQTKSKKVEKNSARDKK 4 G D + + SK ++ + + + K Sbjct: 847 GVDTNVGNKEDSKDLKDDRSVEVK 870 Score = 29.1 bits (62), Expect = 1.7 Identities = 18/85 (21%), Positives = 40/85 (47%), Gaps = 4/85 (4%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK----SSGKDEEYSEQNSSNKSFN 76 +E ++ + + ++ ENKE+++ + DK SV+ E KD++ E K Sbjct: 699 KENNKDSMEDKKLENKESQTDSKDDK--SVDDKQEEAQIYGGESKDDKSVEAKGKKKESK 756 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 + + + + + E+N +KK+ Sbjct: 757 ENKKTKTNENRVRNKEENVQGNKKE 781 Score = 29.1 bits (62), Expect = 1.7 Identities = 19/81 (23%), Positives = 29/81 (35%), Gaps = 1/81 (1%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQ-NSSNKSFNDGDA 64 EK E NK+ + + +DK + K+E+ E N+ K D Sbjct: 920 EKKEGNKEENKDTINTSSKQKGKDKKKKKKESKNSNMKKKEEDKKEYVNNELKKQEDNKK 979 Query: 63 SADYQTKSKKVEKNSARDKKK 1 SK E+N +KK Sbjct: 980 ETTKSENSKLKEENKDNKEKK 1000 Score = 27.9 bits (59), Expect = 4.0 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 7/87 (8%) Frame = -2 Query: 240 EKSESNKK-------SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 82 EK +K SR+ + K+ E T ++K S N S++K K E+ + S K Sbjct: 1040 EKDSEERKSKKEKEESRDLKAKKKEEET-KEKKESENHKSKKKEDKK--EHEDNKSMKKE 1096 Query: 81 FNDGDASADYQTKSKKVEKNSARDKKK 1 + + ++KS+K E++ +D +K Sbjct: 1097 EDKKEKKKHEESKSRKKEEDK-KDMEK 1122 Score = 27.5 bits (58), Expect = 5.3 Identities = 17/83 (20%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN-DG 70 +R S ++ ENK + ST + + + K K+E + S K N + Sbjct: 379 QRNNGVSTNETMNSENKGSGESTNDKMVNATTNDEDHKKENKEETHENNGESVKGENLEN 438 Query: 69 DASADYQTKSKKVEKNSARDKKK 1 A + K + +E ++ K Sbjct: 439 KAGNEESMKGENLENKVGNEELK 461 Score = 27.5 bits (58), Expect = 5.3 Identities = 22/84 (26%), Positives = 33/84 (39%), Gaps = 3/84 (3%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQN-SSNKSFND-- 73 +EK+E+ NKE D++ V + E K EE + SS K D Sbjct: 840 KEKNENGGVDTNVGNKEDSKDLKDDRSVEVKANKEESMKKKREEVQRNDKSSTKEVRDFA 899 Query: 72 GDASADYQTKSKKVEKNSARDKKK 1 + D Q S + K +KK+ Sbjct: 900 NNMDIDVQKGSGESVKYKKDEKKE 923 Score = 27.1 bits (57), Expect = 7.0 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 7/88 (7%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFEN-KEAESSTYRDKNRSVNSGS------ERKSSGKDEEYS 106 E + T E NK+ N KE+E +K S ++ S ++ SS ++ + + Sbjct: 757 ENKKTKTNENRVRNKEENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEA 816 Query: 105 EQNSSNKSFNDGDASADYQTKSKKVEKN 22 ++ S + D + S DYQ+ K EKN Sbjct: 817 KERSGEDNKEDKEESKDYQSVEAK-EKN 843 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 39.5 bits (88), Expect = 0.001 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 11/93 (11%) Frame = -2 Query: 246 EREKSESNKKSREFE--NKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK---- 85 +R+KSES K+ E E KEA ST +++ R S S+++S G++E E + S K Sbjct: 733 KRKKSESKKEGGEGEETQKEANESTKKERKRK-KSESKKQSDGEEETQKEPSESTKKERK 791 Query: 84 -----SFNDGDASADYQTKSKKVEKNSARDKKK 1 S +A + +T+ + VE K+K Sbjct: 792 RKNPESKKKAEAVEEEETRKESVESTKKERKRK 824 Score = 34.3 bits (75), Expect = 0.046 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 5/87 (5%) Frame = -2 Query: 246 EREKSESNKKS--REFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQ---NSSNKS 82 +R+KSES K+S E KE ST +++ R N S++K+ +EE + + S+ K Sbjct: 762 KRKKSESKKQSDGEEETQKEPSESTKKERKRK-NPESKKKAEAVEEEETRKESVESTKKE 820 Query: 81 FNDGDASADYQTKSKKVEKNSARDKKK 1 D + + EK + KKK Sbjct: 821 RKRKKPKHDEEEVPNETEKPEKKKKKK 847 >At5g61150.2 68418.m07672 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 623 Score = 37.9 bits (84), Expect = 0.004 Identities = 21/81 (25%), Positives = 42/81 (51%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 + E SES ++ E+E +E E + R +S E + +++E E+ SN+ ++D D Sbjct: 516 QMEYSESEREESEYETEEEEEEKSPARGRGKDSEDEYEEDAEEDE-EERGKSNR-YSDED 573 Query: 66 ASADYQTKSKKVEKNSARDKK 4 + +++K + S R +K Sbjct: 574 EEEEEGGRAEKDHRGSGRKRK 594 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 37.9 bits (84), Expect = 0.004 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 6/92 (6%) Frame = -2 Query: 261 ERLTVEREKSESNKKSREFEN---KEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 91 E T E+E+S S ++++E EN ++ ES+ + N E++ S EE E+ + Sbjct: 562 ETETKEKEESSSQEETKEKENEKIEKEESAPQEETKEKENEKIEKEESASQEETKEKETE 621 Query: 90 NK---SFNDGDASADYQTKSKKVEKNSARDKK 4 K + ++ + T+S+K E+ +KK Sbjct: 622 TKEKEESSSNESQENVNTESEKKEQVEENEKK 653 Score = 37.9 bits (84), Expect = 0.004 Identities = 19/89 (21%), Positives = 49/89 (55%), Gaps = 1/89 (1%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 +E +E+E+S ++++E EN++ E ++++ S E+++ K++E S N S + Sbjct: 580 KENEKIEKEESAPQEETKEKENEKIE----KEESASQEETKEKETETKEKEESSSNESQE 635 Query: 84 SFN-DGDASADYQTKSKKVEKNSARDKKK 1 + N + + + KK +++++ K+ Sbjct: 636 NVNTESEKKEQVEENEKKTDEDTSESSKE 664 Score = 37.1 bits (82), Expect = 0.007 Identities = 21/98 (21%), Positives = 49/98 (50%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 115 +NED++ +E E ++ E K +E E+ E + ++ N S + KD+ Sbjct: 484 KNEDKETEKIESSFLEETKEKEDETKEKE-ESSSQEKTEEKETETKDNEESSSQEETKDK 542 Query: 114 EYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 E + + + + S + +T++K+ E++S++++ K Sbjct: 543 E--NEKIEKEEASSQEESKENETETKEKEESSSQEETK 578 Score = 33.9 bits (74), Expect = 0.061 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 4/84 (4%) Frame = -2 Query: 243 REKS--ESNKKSREFENKEAESSTYRDK--NRSVNSGSERKSSGKDEEYSEQNSSNKSFN 76 REKS E ++ + +N +E S +K NR ++ E K DE+ + + + ++ Sbjct: 244 REKSGTEESEVEEKKDNGSSEESEVEEKKENRGIDESEESKEKDIDEKANIEEARENNYK 303 Query: 75 DGDASADYQTKSKKVEKNSARDKK 4 DAS++ +S++ S +K Sbjct: 304 GDDASSEVVHESEEKTSESENSEK 327 Score = 31.1 bits (67), Expect = 0.43 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 5/76 (6%) Frame = -2 Query: 240 EKSESN----KKSREFENKE-AESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 76 EK E++ K E E KE ESS+ + N E++ S EE E+ N+ Sbjct: 548 EKEEASSQEESKENETETKEKEESSSQEETKEKENEKIEKEESAPQEETKEK--ENEKIE 605 Query: 75 DGDASADYQTKSKKVE 28 ++++ +TK K+ E Sbjct: 606 KEESASQEETKEKETE 621 Score = 30.7 bits (66), Expect = 0.57 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 9/94 (9%) Frame = -2 Query: 261 ERLTVEREKSESNKK-SREFENKEAESSTYRDKNRSVNSGSER--------KSSGKDEEY 109 E + E E E N+ +EF + ESS S + GS+ +S GK+ E Sbjct: 376 EGIKSEGESMEKNELLEKEFNDSNGESSVTGKSTGSGDGGSQETSEVSSQEESKGKESET 435 Query: 108 SEQNSSNKSFNDGDASADYQTKSKKVEKNSARDK 7 ++ S+ + S D +T++K+ E++S++++ Sbjct: 436 KDKEESSSQ----EESKDRETETKEKEESSSQEE 465 Score = 29.9 bits (64), Expect = 1.00 Identities = 18/89 (20%), Positives = 39/89 (43%), Gaps = 1/89 (1%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS-ERKSSGKDEEYSEQNSSN 88 E+ T E E E EN+++ + + R N G+ E + SG +E E+ N Sbjct: 156 EKSGTEESEVEERKDNGGTEENEKSGTEESEVEERKDNGGTEENEKSGTEESEVEERKEN 215 Query: 87 KSFNDGDASADYQTKSKKVEKNSARDKKK 1 + + S +++ ++ + N ++ + Sbjct: 216 GGTEENEKSGSEESEVEEKKDNGGTEESR 244 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/88 (22%), Positives = 39/88 (44%), Gaps = 3/88 (3%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE--RKSSGKDEEYSEQNSS 91 E+ T E E E + EN+++ S + + N G+E R+ SG +E E+ Sbjct: 200 EKSGTEESEVEERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTEESEVEEKKD 259 Query: 90 NKSFNDGDASADYQTKS-KKVEKNSARD 10 N S + + + + + E++ +D Sbjct: 260 NGSSEESEVEEKKENRGIDESEESKEKD 287 Score = 27.9 bits (59), Expect = 4.0 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%) Frame = -2 Query: 252 TVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-SERKSSGKDEEYSEQNSSNKS-- 82 T E EKS + + E E KE + +K+ S S E+K +G EE E++ + +S Sbjct: 196 TEENEKSGTEESEVE-ERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTEESEV 254 Query: 81 --FNDGDASADYQTKSKK 34 D +S + + + KK Sbjct: 255 EEKKDNGSSEESEVEEKK 272 Score = 26.6 bits (56), Expect = 9.3 Identities = 20/85 (23%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = -2 Query: 252 TVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-SERKSSGKDEEYSEQNSSNKSFN 76 T E EKS + + E E K+ + +K+ + S ERK +G EE + + Sbjct: 152 TEENEKSGTEESEVE-ERKDNGGTEENEKSGTEESEVEERKDNGGTEENEKSGTEESEVE 210 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 + + + K + S ++KK Sbjct: 211 ERKENGGTEENEKSGSEESEVEEKK 235 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 37.9 bits (84), Expect = 0.004 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 6/93 (6%) Frame = -2 Query: 261 ERLTVEREKSESNKKSREFE------NKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQ 100 ER EREK ++++RE E N+E++ RD R G ERK +++ Sbjct: 181 ERDRREREKERGSRRNRERERSREVGNEESDDDVKRDLKRRRKEGGERKEKEREKSVGRS 240 Query: 99 NSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 + S + + K KK + D++K Sbjct: 241 SRHEDSPKRKSVEDNGEKKEKKTREEELEDEQK 273 Score = 35.1 bits (77), Expect = 0.026 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 8/114 (7%) Frame = -2 Query: 318 RDRNQ*IIRNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 139 +DR + E+R+ ++ER ERE E +++ RE KE S R++ RS G+E Sbjct: 152 KDRERREREREEREKERVKERERREREDGERDRRERE---KERGSRRNRERERSREVGNE 208 Query: 138 -------RKSSGKDEEYSEQNSSNKSFNDGDASA-DYQTKSKKVEKNSARDKKK 1 R + +E E+ + + G +S + K K VE N + +KK Sbjct: 209 ESDDDVKRDLKRRRKEGGERKEKEREKSVGRSSRHEDSPKRKSVEDNGEKKEKK 262 Score = 29.5 bits (63), Expect = 1.3 Identities = 18/82 (21%), Positives = 38/82 (46%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 +R+ E +K +E E + RDK+R RKSS +++ E++ +K + Sbjct: 64 DRDDDEEREKRKEKERERRR----RDKDRVKRRSERRKSSDSEDDVEEEDERDKR-RVNE 118 Query: 66 ASADYQTKSKKVEKNSARDKKK 1 ++ + K+ RD+++ Sbjct: 119 KERGHREHERDRGKDRKRDRER 140 Score = 29.1 bits (62), Expect = 1.7 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 1/84 (1%) Frame = -2 Query: 249 VEREKSESNKKSREFENKEAE-SSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 73 +E EKS+ + + +EA+ + RD++R +ERK E+ E++ K Sbjct: 1 MEVEKSKYRSEDLDVVEEEADLKKSRRDRDR----SNERKKDKGSEKRREKDRRKKRVKS 56 Query: 72 GDASADYQTKSKKVEKNSARDKKK 1 D+ DY + E+ ++K++ Sbjct: 57 SDSEDDYD-RDDDEEREKRKEKER 79 Score = 29.1 bits (62), Expect = 1.7 Identities = 19/82 (23%), Positives = 37/82 (45%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 ER++ + K+ RE E + +DK R ER+ ++E E+ + D Sbjct: 127 ERDRGKDRKRDREREER-------KDKEREREKDRERREREREEREKERVKERERRERED 179 Query: 66 ASADYQTKSKKVEKNSARDKKK 1 D + + K E+ S R++++ Sbjct: 180 GERDRREREK--ERGSRRNRER 199 Score = 26.6 bits (56), Expect = 9.3 Identities = 17/97 (17%), Positives = 42/97 (43%) Frame = -2 Query: 291 NEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 112 +E+R+ +ER R+K ++S ++ ++E + R +E K G E Sbjct: 68 DEEREKRKEKERERRRRDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNE-KERGHREH 126 Query: 111 YSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 ++ K + + D + + +K + R++++ Sbjct: 127 ERDRGKDRKRDREREERKDKEREREKDRERREREREE 163 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 37.5 bits (83), Expect = 0.005 Identities = 21/80 (26%), Positives = 38/80 (47%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDAS 61 EKS+ +K ++ + K+ +++ D+ + + K D++Y E+ K +ND D Sbjct: 159 EKSKKKEKEKKKDKKKDGNNSEDDEFKKKKKKEQYKEHHDDDDYDEKKKKKKDYNDDD-- 216 Query: 60 ADYQTKSKKVEKNSARDKKK 1 K KK N D+KK Sbjct: 217 ----EKKKKKHYNDDDDEKK 232 Score = 33.1 bits (72), Expect = 0.11 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 8/96 (8%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 E+ +++K +N + EF+ K+ + Y++ + + E+K KD ++ K Sbjct: 165 EKEKKKDKKKDGNNSEDDEFKKKKKKEQ-YKEHHDD-DDYDEKKKKKKDYNDDDEKKKKK 222 Query: 84 SFNDGD--------ASADYQTKSKKVEKNSARDKKK 1 +ND D + D K KK E + DKKK Sbjct: 223 HYNDDDDEKKKKHNYNDDDDEKKKKKEYHDDEDKKK 258 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 Query: 120 DEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 D + + S K ++DGD KSKK EK +DKKK Sbjct: 141 DGDDGHKKHSGKDYDDGDE------KSKKKEKEKKKDKKK 174 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 37.5 bits (83), Expect = 0.005 Identities = 23/88 (26%), Positives = 44/88 (50%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 +ER ERE+ + K R + +E++ T D + + +RK +D ++ ++ +N Sbjct: 823 KERREKEREREKEKGKERS-KREESDGETAMDVSEG-HKDEKRKGKDRDRKHRRRHHNN- 879 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKKK 1 S D + D + +SKK + D+KK Sbjct: 880 SDEDVSSDRDDRDESKKSSRKHGNDRKK 907 Score = 36.7 bits (81), Expect = 0.009 Identities = 19/85 (22%), Positives = 34/85 (40%) Frame = -2 Query: 267 LEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 88 L+E+ + K + K +E E E E +DK R K GK+ E++ Sbjct: 790 LQEKAKEKERKRDEEKVRKEKERDEKEKRKDKDKERREKEREREKEKGKERSKREESDGE 849 Query: 87 KSFNDGDASADYQTKSKKVEKNSAR 13 + + + D + K K ++ R Sbjct: 850 TAMDVSEGHKDEKRKGKDRDRKHRR 874 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 37.1 bits (82), Expect = 0.007 Identities = 28/84 (33%), Positives = 41/84 (48%) Frame = -2 Query: 252 TVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 73 TVE E + SNKK E N+ +E S YR + G ER+ EE + S KS D Sbjct: 12 TVE-EGAGSNKKKEESGNERSERS-YRKRE-----GGERQGEEGGEEERVSSRSKKSRGD 64 Query: 72 GDASADYQTKSKKVEKNSARDKKK 1 G+ + + ++ S+RDK + Sbjct: 65 GEENGGGKRDRERERHRSSRDKDR 88 Score = 29.1 bits (62), Expect = 1.7 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 5/84 (5%) Frame = -2 Query: 318 RDRNQ*IIRNEDRQA*WLEERLTVEREKSESNK-KSREFENKEAESSTYRDKNRS----V 154 +DR + +R R ER + ER++S+ +K + RE +E SS+ + V Sbjct: 86 KDRERDKVREGSRDKESDRERSSKERDRSDRDKPRDRERREREKRSSSRSRREEKEPEVV 145 Query: 153 NSGSERKSSGKDEEYSEQNSSNKS 82 GS R KDE ++ ++ Sbjct: 146 ERGSRRHRDKKDEPEADPERDQRT 169 >At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 3 WD-40 repeats (PF00400);similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56 (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens] Length = 1305 Score = 37.1 bits (82), Expect = 0.007 Identities = 20/78 (25%), Positives = 40/78 (51%) Frame = -2 Query: 234 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD 55 S+S+KKS N ++ + D N + S+ S K ++ S+ ++++KS GD + Sbjct: 1170 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGDTNSKSQKKGDGDSS 1229 Query: 54 YQTKSKKVEKNSARDKKK 1 ++ K +S++ KK Sbjct: 1230 SKSHKKNDGDSSSKSHKK 1247 Score = 36.7 bits (81), Expect = 0.009 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 2/79 (2%) Frame = -2 Query: 234 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF--NDGDAS 61 S+S+KKS N ++ + D N + S+ S+ K + S+ +S++KS +DGD+ Sbjct: 1146 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSC 1205 Query: 60 ADYQTKSKKVEKNSARDKK 4 + Q KS + NS KK Sbjct: 1206 SKSQKKSDG-DTNSKSQKK 1223 Score = 36.3 bits (80), Expect = 0.011 Identities = 19/78 (24%), Positives = 40/78 (51%) Frame = -2 Query: 234 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD 55 S+S+KKS N ++ + D N + S+ S+ K + S+ +S++KS D ++ Sbjct: 1122 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSN 1181 Query: 54 YQTKSKKVEKNSARDKKK 1 ++ K ++++ KK Sbjct: 1182 SKSSKKSDGDSNSKSSKK 1199 Score = 35.9 bits (79), Expect = 0.015 Identities = 19/78 (24%), Positives = 40/78 (51%) Frame = -2 Query: 234 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD 55 S+S+KKS N ++ + D N + S+ S+ K + S+ +S++KS D ++ Sbjct: 1134 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSN 1193 Query: 54 YQTKSKKVEKNSARDKKK 1 ++ K + ++ +KK Sbjct: 1194 SKSSKKSDGDSCSKSQKK 1211 Score = 35.1 bits (77), Expect = 0.026 Identities = 20/78 (25%), Positives = 39/78 (50%) Frame = -2 Query: 234 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD 55 S+S+KKS N ++ + D N + S+ S+ K + S+ +S +KS D + Sbjct: 1158 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGDTN 1217 Query: 54 YQTKSKKVEKNSARDKKK 1 +++ K +S++ KK Sbjct: 1218 SKSQKKGDGDSSSKSHKK 1235 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 37.1 bits (82), Expect = 0.007 Identities = 19/84 (22%), Positives = 37/84 (44%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 +ER ERE+ E K+ E +E E + R++ R + + ++EE + K Sbjct: 613 QERQKKEREEMERKKREEEARKREEEMAKIREEERQRKEREDVERKRREEEAMRREEERK 672 Query: 84 SFNDGDASADYQTKSKKVEKNSAR 13 + A+ + + K+ E+ R Sbjct: 673 REEEAAKRAEEERRKKEEEEEKRR 696 Score = 28.7 bits (61), Expect = 2.3 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 7/95 (7%) Frame = -2 Query: 264 EERLTVERE------KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE-EYS 106 EER ERE + E +K RE E ++ E R++ + ER+ ++E E Sbjct: 535 EERQRKEREEVERKRREEQERKRREEEARKREEERKREEEMAKRREQERQRKEREEVERK 594 Query: 105 EQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 + + + A Q + KK + R K++ Sbjct: 595 IREEQERKREEEMAKRREQERQKKEREEMERKKRE 629 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 112 +ER ERE+ E + + +E E + R++ R E + ++EE Sbjct: 581 QERQRKEREEVERKIREEQERKREEEMAKRREQERQKKEREEMERKKREEE 631 >At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 930 Score = 35.9 bits (79), Expect = 0.015 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 6/86 (6%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSG----SERKSSGKDEEYSEQNSSNKSFN 76 +EK E S ++E +S R+K+ SG S +SSG + N ++ N Sbjct: 801 KEKVEEKTSSLTLGSEEEKSRKKREKSPGKRSGGNDLSSSESSGDERRRKRYNKKDRHRN 860 Query: 75 D--GDASADYQTKSKKVEKNSARDKK 4 D D+S+DY ++ K+ ++ ++ ++ Sbjct: 861 DSESDSSSDYHSRDKQGSRSRSKRRE 886 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 35.5 bits (78), Expect = 0.020 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 1/82 (1%) Frame = -2 Query: 246 EREKSESNKKSR-EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 70 ER+K + KK R E + +EAE R+K S S+ K K E+ +++ + + Sbjct: 7 ERKKEKKEKKERKERKRREAEELAVREKKISKKHKSKSKEEEKPEKSKKKSKKYEEVEEE 66 Query: 69 DASADYQTKSKKVEKNSARDKK 4 + S KK +++ + K+ Sbjct: 67 EKSPSPSPSPKKSKESKKKHKR 88 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 35.1 bits (77), Expect = 0.026 Identities = 20/82 (24%), Positives = 34/82 (41%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 E+E + +K E +E E ++K SG E K+ D+E ++ S + + Sbjct: 112 EKEHKKGKEKKHEELEEEKEGKKKKNKKEKDESGPEEKNKKADKEKKHEDVSQEKEELEE 171 Query: 66 ASADYQTKSKKVEKNSARDKKK 1 K +K E + KKK Sbjct: 172 EDGKKNKKKEKDESGTEEKKKK 193 Score = 35.1 bits (77), Expect = 0.026 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 1/78 (1%) Frame = -2 Query: 234 SESNKKSREFENKEAESSTYR-DKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 58 +E KK + E KE + ST + DK G K +DE + D +A Sbjct: 260 AEEKKKKPDKEKKEKDESTEKEDKKLKGKKGKGEKPEKEDEGKKTKEHDATEQEMDDEAA 319 Query: 57 DYQTKSKKVEKNSARDKK 4 D++ KK K+ A+ K+ Sbjct: 320 DHKEGKKKKNKDKAKKKE 337 Score = 29.9 bits (64), Expect = 1.00 Identities = 17/76 (22%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = -2 Query: 246 EREKSESNKKSREF--ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 73 E + +E KKS+ E++E + +DK ++ ++ +DEE + +S + Sbjct: 407 EEDDTEEKKKSKVEGGESEEGKKKKKKDKKKNKKKDTKEPKMTEDEEEKKDDSKDVKIEG 466 Query: 72 GDASADYQTKSKKVEK 25 A + + K K +K Sbjct: 467 SKAKEEKKDKDVKKKK 482 Score = 28.7 bits (61), Expect = 2.3 Identities = 22/88 (25%), Positives = 35/88 (39%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 E+ ++EK + S+E E E E K SG+E K K ++ +Q +K Sbjct: 148 EKNKKADKEKKHEDV-SQEKEELEEEDGKKNKKKEKDESGTEEKKK-KPKKEKKQKEESK 205 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKKK 1 S D + K + +KKK Sbjct: 206 SNEDKKVKGKKEKGEKGDLEKEDEEKKK 233 Score = 27.1 bits (57), Expect = 7.0 Identities = 19/88 (21%), Positives = 39/88 (44%), Gaps = 6/88 (6%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNR-SVNSGSERKSSGKDEEYSEQ-----NSSNK 85 E+++S +K+++ + ++ ++K G + K KDE +E+ K Sbjct: 140 EKDESGPEEKNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESGTEEKKKKPKKEKK 199 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKKK 1 + ++ D + K KK EK D +K Sbjct: 200 QKEESKSNEDKKVKGKK-EKGEKGDLEK 226 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 34.7 bits (76), Expect = 0.035 Identities = 21/71 (29%), Positives = 30/71 (42%) Frame = -2 Query: 237 KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 58 +SES + + E E+E R K + E K + ++ NKS DGD Sbjct: 111 ESESESEYSDSEESESEDERRRRKRKRKEREEEEKERKRRRREKDKKKRNKSDKDGDKKR 170 Query: 57 DYQTKSKKVEK 25 + K KK EK Sbjct: 171 K-EKKKKKSEK 180 >At5g61150.1 68418.m07671 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 625 Score = 34.3 bits (75), Expect = 0.046 Identities = 19/81 (23%), Positives = 37/81 (45%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 + E SES ++ E+E +E E + R +S E + +++E S+ S D + Sbjct: 516 QMEYSESEREESEYETEEEEEEKSPARGRGKDSEDEYEEDAEEDEEERGKSNRYSDEDEE 575 Query: 66 ASADYQTKSKKVEKNSARDKK 4 +++K + S R +K Sbjct: 576 EEEVAGGRAEKDHRGSGRKRK 596 Score = 30.7 bits (66), Expect = 0.57 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 115 R +D + + E+ E E+ +SN+ S E E +E + +K+ SG +RK DE Sbjct: 544 RGKDSEDEYEEDAEEDEEERGKSNRYSDEDEEEEEVAGGRAEKDHR-GSGRKRKGIESDE 602 Query: 114 EYS 106 E S Sbjct: 603 EES 605 >At5g58880.1 68418.m07377 hypothetical protein Length = 1088 Score = 34.3 bits (75), Expect = 0.046 Identities = 26/82 (31%), Positives = 43/82 (52%) Frame = -2 Query: 261 ERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 82 +RL +E E + +++ KEA T D ++SV S RKS K+ E +++ SNK Sbjct: 365 KRLDLENEYIDHTEQNLPLNGKEA---TIEDDDKSVVS---RKSEEKEVEMNDETDSNKE 418 Query: 81 FNDGDASADYQTKSKKVEKNSA 16 D D+S +++S+ N A Sbjct: 419 ECD-DSSCSEESESELCRLNKA 439 >At2g27470.1 68415.m03320 CCAAT-box binding transcription factor subunit HAP3-related contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to polymerase epsilon p17 subunit (DNA polymerase epsilon subunit 3) (YB-like protein 1) (YBL1) (NF-YB-like protein) (SP:Q9JKP7) [Mus musculus]; Length = 275 Score = 34.3 bits (75), Expect = 0.046 Identities = 15/77 (19%), Positives = 35/77 (45%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 E E ++ + E++ + +T + N N + +G DEE +++ N +G+ Sbjct: 172 ENGNDEEDENGNDEEDENDDENTEENGNDEENDDENTEENGNDEENEKEDEENSMEENGN 231 Query: 66 ASADYQTKSKKVEKNSA 16 S + + +E+N + Sbjct: 232 ESEESGNEDHSMEENGS 248 Score = 31.5 bits (68), Expect = 0.33 Identities = 18/82 (21%), Positives = 35/82 (42%), Gaps = 1/82 (1%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVN-SGSERKSSGKDEEYSEQNSSN 88 ++ T E E N EN E + D+ S+ +G+E + SG ++ E+N S Sbjct: 190 DDENTEENGNDEENDDENTEENGNDEENEKEDEENSMEENGNESEESGNEDHSMEENGSG 249 Query: 87 KSFNDGDASADYQTKSKKVEKN 22 ++ + ++VE + Sbjct: 250 VGEDNENEDGSVSGSGEEVESD 271 Score = 27.5 bits (58), Expect = 5.3 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDAS 61 E+ E++ ++ E + E+ D+N N G++ ++ +DEE S + + N+S G+ Sbjct: 185 EEDENDDENTEENGNDEEND---DENTEEN-GNDEENEKEDEENSMEENGNESEESGNED 240 Query: 60 ADYQTKSKKV-EKNSARD 10 + V E N D Sbjct: 241 HSMEENGSGVGEDNENED 258 Score = 27.1 bits (57), Expect = 7.0 Identities = 17/74 (22%), Positives = 28/74 (37%) Frame = -2 Query: 231 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADY 52 E N E EN E D+N N E D+E +E+N +++ D Sbjct: 171 EENGNDEEDENGNDEEDENDDENTEENGNDEEN----DDENTEENGNDEENEKEDEENSM 226 Query: 51 QTKSKKVEKNSARD 10 + + E++ D Sbjct: 227 EENGNESEESGNED 240 >At4g15030.1 68417.m02309 expressed protein Length = 179 Score = 33.9 bits (74), Expect = 0.061 Identities = 19/64 (29%), Positives = 30/64 (46%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EE E E+SESN+K ++ N+ S Y G RKS K E + ++ Sbjct: 108 EEEKRKEGERSESNEKKKQKRNRSQSHSEYDTDEEDRRKGKTRKS--KLESADREGKDDE 165 Query: 84 SFND 73 +F++ Sbjct: 166 NFDE 169 >At3g59800.1 68416.m06673 expressed protein Length = 186 Score = 33.9 bits (74), Expect = 0.061 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 E L + + ++ S+ KSR+ + K+ +S + K R S SE SS ++E SS+K Sbjct: 90 ERSLKLSKGRNYSSDKSRK-DKKDRDSKKKKSKKRKHYSSSESSSSSDEDESRRSRSSSK 148 >At1g78110.1 68414.m09103 expressed protein Length = 342 Score = 33.9 bits (74), Expect = 0.061 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -2 Query: 270 WLEERLTV--EREKSESNKKSREFENKEAESSTYRDKNRSV 154 WLEER+ V E+EK E K+ +E E++E T + RS+ Sbjct: 256 WLEERMKVKTEQEKREEQKEEKETEDQETSMKTKKKDLRSL 296 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 33.5 bits (73), Expect = 0.081 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = -2 Query: 264 EERLTVEREKSESNKKSRE-FENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 88 E+ ++ R+K KSR+ + K+ E R K+R N K KD ++ +S Sbjct: 75 EKEISRGRDKEREKDKSRDRVKEKDKEKERNRHKDRE-NERDNEKEKDKDRARVKERASK 133 Query: 87 KSFNDGD 67 KS D D Sbjct: 134 KSHEDDD 140 Score = 32.7 bits (71), Expect = 0.14 Identities = 22/93 (23%), Positives = 50/93 (53%), Gaps = 6/93 (6%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRS-VNSGSERKSSGKD 118 R+++R+ +R+ E++K + + ++ EN E ++ +DK+R+ V + +KS D Sbjct: 82 RDKEREKDKSRDRVK-EKDKEKERNRHKDREN-ERDNEKEKDKDRARVKERASKKSHEDD 139 Query: 117 EEYSE-----QNSSNKSFNDGDASADYQTKSKK 34 +E + ++S N+ N+G + D + K+ Sbjct: 140 DETHKAAERYEHSDNRGLNEGGDNVDAASSGKE 172 Score = 31.9 bits (69), Expect = 0.25 Identities = 18/83 (21%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK-SSGKDEEYSEQNSSNKSFNDG 70 ++EK +K R+ +++ + RD+ RS + +E++ S G+D+E + S ++ Sbjct: 41 DKEKDYDREKIRDKDHRR-DKEKERDRKRSRDEDTEKEISRGRDKEREKDKSRDRVKEKD 99 Query: 69 DASADYQTKSKKVEKNSARDKKK 1 + K ++ E+++ ++K K Sbjct: 100 KEKERNRHKDRENERDNEKEKDK 122 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 33.5 bits (73), Expect = 0.081 Identities = 23/85 (27%), Positives = 37/85 (43%), Gaps = 5/85 (5%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE---EYSEQNSSNKSFNDG 70 E+ E K E KEAE + + N N+G K + E E S + + ++ Sbjct: 109 EREEEEKAVEENNEKEAEGTGNEEGNEDSNNGESEKVVDESEGGNEISNEEAREINYKGD 168 Query: 69 DASAD--YQTKSKKVEKNSARDKKK 1 DAS++ + T+ K EK + K Sbjct: 169 DASSEVMHGTEEKSNEKVEVEGESK 193 Score = 31.1 bits (67), Expect = 0.43 Identities = 19/84 (22%), Positives = 42/84 (50%) Frame = -2 Query: 252 TVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 73 T E+ S+SN + E + ++ + + S SGS KS+G + +E++ K + Sbjct: 247 TGEKGFSDSNGELPETNLSTSNATETTESSGSDESGSSGKSTGYQQTKNEEDEKEKVQSS 306 Query: 72 GDASADYQTKSKKVEKNSARDKKK 1 + S ++ + + +S++D+ K Sbjct: 307 EEESKVKESGKNEKDASSSQDESK 330 Score = 29.9 bits (64), Expect = 1.00 Identities = 21/90 (23%), Positives = 38/90 (42%), Gaps = 2/90 (2%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK--DEEYSEQNSS 91 EE E E E S + EN+ E+ + S G+E K + K E ++N++ Sbjct: 365 EESKEEEPENKEKEASSSQEENEIKETEIKEKEESSSQEGNENKETEKKSSESQRKENTN 424 Query: 90 NKSFNDGDASADYQTKSKKVEKNSARDKKK 1 ++ + S D K E+ + K++ Sbjct: 425 SEKKIEQVESTDSSNTQKGDEQKTDESKRE 454 >At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family protein / snRNP family protein contains similarity to U4/U6 small nuclear ribonucleoprotein hPrp3 [Homo sapiens] gi|2708307|gb|AAC51926 Length = 786 Score = 33.5 bits (73), Expect = 0.081 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 +R S+ + SR + ++ T + RSV G ER+ S E++ + S ++G Sbjct: 39 KRRDSDHYRSSRRGDREDERDRTKDRRGRSVERG-EREGSRDREKHHHERS-----HEGS 92 Query: 66 ASADYQTKSK-KVEKNSARDKKK 1 + ++K K + E+N ARD KK Sbjct: 93 KEKESRSKRKDREEENGARDGKK 115 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 33.1 bits (72), Expect = 0.11 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 1/85 (1%) Frame = -2 Query: 261 ERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 82 ER + +KS+ E N++ E+ ++ R ++K + KDE+ ++ K Sbjct: 114 ERDEKKMKKSKDADVVDEKVNEKLEAEQRSEERRERKKEKKKKKNNKDEDVVDEKVKEK- 172 Query: 81 FNDGDASAD-YQTKSKKVEKNSARD 10 D SAD + K KK +KN+ D Sbjct: 173 LEDEQKSADRKERKKKKSKKNNDED 197 Score = 31.1 bits (67), Expect = 0.43 Identities = 18/88 (20%), Positives = 34/88 (38%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EER ++EK + E E D+ +S + +K K + + Sbjct: 144 EERRERKKEKKKKKNNKDEDVVDEKVKEKLEDEQKSADRKERKKKKSKKNNDEDVVDEKE 203 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKKK 1 D SA+ + K K +++ +K+K Sbjct: 204 KLEDEQKSAEIKEKKKNKDEDVVDEKEK 231 Score = 30.7 bits (66), Expect = 0.57 Identities = 17/86 (19%), Positives = 40/86 (46%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 E+R RE+ + KK + ++++ ++K ++RK K + S++N+ Sbjct: 140 EQRSEERRERKKEKKKKKNNKDEDVVDEKVKEKLEDEQKSADRKERKKKK--SKKNNDED 197 Query: 84 SFNDGDASADYQTKSKKVEKNSARDK 7 ++ + D Q ++ EK +D+ Sbjct: 198 VVDEKEKLEDEQKSAEIKEKKKNKDE 223 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/81 (20%), Positives = 35/81 (43%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 E++ +E+ + K E+ E D+ +S ++K+ KDE+ ++ K Sbjct: 176 EQKSADRKERKKKKSKKNNDEDVVDEKEKLEDEQKSAEIKEKKKN--KDEDVVDEKEKEK 233 Query: 84 SFNDGDASADYQTKSKKVEKN 22 D S + + + KK K+ Sbjct: 234 -LEDEQRSGERKKEKKKKRKS 253 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 33.1 bits (72), Expect = 0.11 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 7/87 (8%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRD----KNRSVNSGSERKSSG---KDEEYSEQNSSNKS 82 E + +NKKS + E+E D K + V E +G K E+ + Q S ++ Sbjct: 513 EATRTNKKSVAHSDDESEEEKEDDEEEEKEQEVEEEEEENENGIPDKSEDEAPQLSESEE 572 Query: 81 FNDGDASADYQTKSKKVEKNSARDKKK 1 + + ++ +TK KK ++ DKK+ Sbjct: 573 NVESEEESEEETKKKKRGSRTSSDKKE 599 Score = 29.9 bits (64), Expect = 1.00 Identities = 18/84 (21%), Positives = 41/84 (48%), Gaps = 2/84 (2%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE--QNSSNKSFND 73 E K E K++ + ++ EA++ + + S+ ++ K+EE + + S + ++ Sbjct: 208 ETNKGEEVKEANKEDDVEADTKVAEPEVEDKKTESKDENEDKEEEKEDEKEESMDDKEDE 267 Query: 72 GDASADYQTKSKKVEKNSARDKKK 1 + S D + +K E N ++ KK Sbjct: 268 KEESNDDDKEDEKEESNDDKEDKK 291 Score = 27.1 bits (57), Expect = 7.0 Identities = 20/83 (24%), Positives = 35/83 (42%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EE+ E E+ E + E EN+ D+ + SE + + + EE SE+ + K Sbjct: 531 EEKEDDEEEEKEQEVEEEEEENENGIPDKSEDEAPQL---SESEENVESEEESEEETKKK 587 Query: 84 SFNDGDASADYQTKSKKVEKNSA 16 +S ++ K K +A Sbjct: 588 KRGSRTSSDKKESAGKSRSKKTA 610 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/85 (21%), Positives = 35/85 (41%), Gaps = 3/85 (3%) Frame = -2 Query: 249 VEREKSES---NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 79 VE +K+ES N+ E + E E S ++ S + K K+E ++ + Sbjct: 235 VEDKKTESKDENEDKEEEKEDEKEESMDDKEDEKEESNDDDKEDEKEESNDDKEDKKEDI 294 Query: 78 NDGDASADYQTKSKKVEKNSARDKK 4 + +T+ + + S +KK Sbjct: 295 KKSNKRGKGKTEKTRGKTKSDEEKK 319 >At5g53930.1 68418.m06710 expressed protein Length = 529 Score = 33.1 bits (72), Expect = 0.11 Identities = 24/92 (26%), Positives = 46/92 (50%), Gaps = 8/92 (8%) Frame = -2 Query: 252 TVEREKSESNKKSR------EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 91 +V+++KS+ NK + E E+ ++SS Y +R+S + ++ SS Sbjct: 20 SVKKKKSKRNKSKKIRRIKDESESSGSDSSLYSSSEDDYRRKKKRRSKLSKKRSRKRYSS 79 Query: 90 NKSFNDGDASADYQTK--SKKVEKNSARDKKK 1 ++S +D D + K SK+ ++N + KKK Sbjct: 80 SESDDDSDDDRLLKKKKRSKRKDENVGKKKKK 111 >At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein contains Pfam PF00096: Zinc finger, C2H2 type Length = 812 Score = 33.1 bits (72), Expect = 0.11 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 4/82 (4%) Frame = -2 Query: 252 TVEREKSESNKKSREFENKEAESSTYR-DKNRSVNSGSERKSSGKDEEYSEQNSSNK-SF 79 TV R +S N + E E + +TYR DK +S G++ S+G ++ + + ++ Sbjct: 701 TVRRLQSSQNPQEEEEEAISKDKNTYRSDKGKSQVVGTDSSSTGSKQQRKKTSKFHRVRL 760 Query: 78 NDGDASA--DYQTKSKKVEKNS 19 DG +A D +++ E+ S Sbjct: 761 GDGSMAALLDLNNSTRESEQES 782 >At5g60530.1 68418.m07590 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 439 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/69 (24%), Positives = 34/69 (49%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 ++EK + +K+ +E ++KE + +DK ERK + E+ + K + + Sbjct: 75 KKEKEKKDKEEKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEK-ERKAKEKKDKEESE 133 Query: 66 ASADYQTKS 40 A+A Y+ S Sbjct: 134 AAARYRILS 142 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/71 (21%), Positives = 28/71 (39%) Frame = -2 Query: 231 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADY 52 E KK +E K+ + +DK ERK K ++ ++ + + Sbjct: 62 EQEKKDKEKAAKDKKEKEKKDKEEKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEKER 121 Query: 51 QTKSKKVEKNS 19 + K KK ++ S Sbjct: 122 KAKEKKDKEES 132 Score = 28.7 bits (61), Expect = 2.3 Identities = 12/44 (27%), Positives = 26/44 (59%) Frame = -2 Query: 288 EDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRS 157 +D++ E++ +E+EK + +K +E + KE ++ +DK S Sbjct: 89 KDKERKEKEKKDKLEKEKKDKERKEKERKEKERKAKEKKDKEES 132 Score = 28.3 bits (60), Expect = 3.0 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKS-SGKDEEYSE 103 E++ E+EK + +K +E ++K + +++ ERK+ KD+E SE Sbjct: 79 EKKDKEEKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEKERKAKEKKDKEESE 133 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 32.7 bits (71), Expect = 0.14 Identities = 18/85 (21%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE---YSEQNSSNKSFN 76 E+ K S K R+ + SS +RD +R G R+ G+D++ S ++ + Sbjct: 80 EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RGERRERGGRDDDDYRRSRDRDHDRRRD 137 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 D +++S+ +++ R + + Sbjct: 138 DRGGRRSRRSRSRSKDRSERRTRSR 162 Score = 29.9 bits (64), Expect = 1.00 Identities = 26/106 (24%), Positives = 52/106 (49%), Gaps = 1/106 (0%) Frame = -2 Query: 318 RDRNQ*IIRNEDRQA*WLEERLTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 142 RD + R++DR+ E+ +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRER---EKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 141 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKK 4 R S +D + D D DY+ +S+ + + RD + Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD---DYR-RSRDRDHDRRRDDR 139 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 32.7 bits (71), Expect = 0.14 Identities = 18/85 (21%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE---YSEQNSSNKSFN 76 E+ K S K R+ + SS +RD +R G R+ G+D++ S ++ + Sbjct: 80 EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RGERRERGGRDDDDYRRSRDRDHDRRRD 137 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 D +++S+ +++ R + + Sbjct: 138 DRGGRRSRRSRSRSKDRSERRTRSR 162 Score = 29.9 bits (64), Expect = 1.00 Identities = 26/106 (24%), Positives = 52/106 (49%), Gaps = 1/106 (0%) Frame = -2 Query: 318 RDRNQ*IIRNEDRQA*WLEERLTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 142 RD + R++DR+ E+ +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRER---EKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 141 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKK 4 R S +D + D D DY+ +S+ + + RD + Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD---DYR-RSRDRDHDRRRDDR 139 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 32.7 bits (71), Expect = 0.14 Identities = 18/85 (21%), Positives = 39/85 (45%), Gaps = 3/85 (3%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE---YSEQNSSNKSFN 76 E+ K S K R+ + SS +RD +R G R+ G+D++ S ++ + Sbjct: 80 EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RGERRERGGRDDDDYRRSRDRDHDRRRD 137 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 D +++S+ +++ R + + Sbjct: 138 DRGGRRSRRSRSRSKDRSERRTRSR 162 Score = 29.9 bits (64), Expect = 1.00 Identities = 26/106 (24%), Positives = 52/106 (49%), Gaps = 1/106 (0%) Frame = -2 Query: 318 RDRNQ*IIRNEDRQA*WLEERLTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 142 RD + R++DR+ E+ +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRER---EKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 141 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKK 4 R S +D + D D DY+ +S+ + + RD + Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD---DYR-RSRDRDHDRRRDDR 139 >At2g46900.1 68415.m05857 expressed protein contains Pfam profile PF04910: Protein of unknown function, DUF654 Length = 627 Score = 32.7 bits (71), Expect = 0.14 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 1/90 (1%) Frame = -2 Query: 267 LEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD-EEYSEQNSS 91 L +++ E E S+ K E E ++ E S R S+N +D EE ++ + Sbjct: 5 LLKKVLQEHEDSKLQKHHEEEEEEDEEESGARS---SINPFDLLNDGDEDPEEIDDETIA 61 Query: 90 NKSFNDGDASADYQTKSKKVEKNSARDKKK 1 K D D + + V KN ++ KKK Sbjct: 62 EKKNEDADHQSSVADHVQPVSKNKSKKKKK 91 >At5g16680.1 68418.m01951 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1290 Score = 32.3 bits (70), Expect = 0.19 Identities = 21/63 (33%), Positives = 28/63 (44%) Frame = -2 Query: 249 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 70 V EK +KSR NKE + + RS E + GK + S NSS S ++ Sbjct: 218 VSSEKGNFKEKSRPGGNKERQEPSVEGSTRS----GENRKDGKSSKSSSSNSSAVSESES 273 Query: 69 DAS 61 D S Sbjct: 274 DDS 276 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 32.3 bits (70), Expect = 0.19 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 1/89 (1%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EER REK + ++SRE +++ + RD+ R +R G+D + + ++ Sbjct: 263 EER-EKSREKGKERERSRELSHEQPRERS-RDRPREDKHHRDRDQGGRDRDRDSRRDRDR 320 Query: 84 SFNDGDAS-ADYQTKSKKVEKNSARDKKK 1 + + GD D + ++ RD+ + Sbjct: 321 TRDRGDRDRRDRDRGRDRTSRDHDRDRSR 349 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 32.3 bits (70), Expect = 0.19 Identities = 20/81 (24%), Positives = 38/81 (46%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 64 R + E R+ E + + T R ++RSV ++ K +DEE ++S Sbjct: 634 RRRKEVKSTPRDDEENKVKRRT-RSRSRSVEDSADIKDKSRDEELKHHKKRSRS-----R 687 Query: 63 SADYQTKSKKVEKNSARDKKK 1 S + ++K++ +NS K+K Sbjct: 688 SREDRSKTRDTSRNSDEAKQK 708 Score = 27.5 bits (58), Expect = 5.3 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 2/86 (2%) Frame = -2 Query: 252 TVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 73 T R+K + R + +E RD S E+KS K ++S ++S Sbjct: 806 TRSRDKKSKRRSGRRSRSPSSEGKQGRDIRSSPGYSDEKKSRHK------RHSRSRSIEK 859 Query: 72 GDASADYQTKSKKVEKNSA--RDKKK 1 ++S D ++K + ++S+ RDK++ Sbjct: 860 KNSSRDKRSKRHERLRSSSPGRDKRR 885 Score = 27.1 bits (57), Expect = 7.0 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG-D 67 +E SE ++ R+ ++ E + R +RS E KS+ +D+E ++ +S + + Sbjct: 605 QEDSELSRLRRDSSSR-GEKKSSRAGSRSPRRRKEVKSTPRDDEENKVKRRTRSRSRSVE 663 Query: 66 ASADYQTKSKKVE 28 SAD + KS+ E Sbjct: 664 DSADIKDKSRDEE 676 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 32.3 bits (70), Expect = 0.19 Identities = 20/79 (25%), Positives = 37/79 (46%) Frame = -2 Query: 249 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 70 +++ K E K + E E + + + S + E K S + E+Y++QN + ND Sbjct: 1481 IQQTKDELEKPRKPSEISE-NHNIHEFMDSSQSQDIEEKGSDQAEKYAKQNKIQEVMNDE 1539 Query: 69 DASADYQTKSKKVEKNSAR 13 D +Y S++V A+ Sbjct: 1540 DKKEEYHI-SERVRNEMAK 1557 >At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 387 Score = 31.9 bits (69), Expect = 0.25 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -2 Query: 138 RKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 R + E + SNK+F+ GD S +++K E N R K+K Sbjct: 179 RAHDAAEREKGKSKKSNKNFSPGDVSDREAKETRKKESNEKRIKRK 224 >At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 570 Score = 31.9 bits (69), Expect = 0.25 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -2 Query: 138 RKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 R + E + SNK+F+ GD S +++K E N R K+K Sbjct: 179 RAHDAAEREKGKSKKSNKNFSPGDVSDREAKETRKKESNEKRIKRK 224 >At2g34300.1 68415.m04196 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 31.9 bits (69), Expect = 0.25 Identities = 17/82 (20%), Positives = 43/82 (52%), Gaps = 2/82 (2%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKN-RSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 64 EK+E+ ++ +E ++ + ++KN + V S S+ + + + E NKS DG+ Sbjct: 112 EKTEAGEERKESDDNNGDGDGEKEKNVKEVGSESDETTQKEKTQLEESTEENKS-EDGNG 170 Query: 63 SAD-YQTKSKKVEKNSARDKKK 1 + + + + + E+++ + K+ Sbjct: 171 NEEKAEENASETEESTEKSSKE 192 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/88 (18%), Positives = 34/88 (38%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 +E+ +E+N+ + EN + +G ERK S D K Sbjct: 78 DEKNEENEAATENNQVKTDSENSAEGNQVNESSGEKTEAGEERKES-DDNNGDGDGEKEK 136 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKKK 1 + + + +D T+ +K + + ++ K Sbjct: 137 NVKEVGSESDETTQKEKTQLEESTEENK 164 >At5g12230.1 68418.m01435 expressed protein Length = 221 Score = 31.5 bits (68), Expect = 0.33 Identities = 17/81 (20%), Positives = 42/81 (51%), Gaps = 1/81 (1%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 +R+K + +++ ++ ++K + S +DK++ + ++ ++S+++ K +DGD Sbjct: 134 DRDK-DKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSGDHSKKHHDKKRKHDGD 192 Query: 66 ASA-DYQTKSKKVEKNSARDK 7 D Q K K+S D+ Sbjct: 193 EDLNDVQRHKKNKHKSSKLDE 213 >At4g35940.1 68417.m05113 expressed protein Length = 451 Score = 31.5 bits (68), Expect = 0.33 Identities = 19/75 (25%), Positives = 32/75 (42%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 E+ K E +K R + K+ + R + + ++ GK E SE+ S + + Sbjct: 32 EKAKKEQRRKDRRSDKKDKKDKKERKEKKEKKEKKRKEREGK-EVGSEKRSHKRRRKEDG 90 Query: 66 ASADYQTKSKKVEKN 22 A D K K+ E N Sbjct: 91 AKVDLFHKLKESEVN 105 >At4g33740.2 68417.m04791 expressed protein Length = 227 Score = 31.5 bits (68), Expect = 0.33 Identities = 20/85 (23%), Positives = 34/85 (40%), Gaps = 3/85 (3%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAES---STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 76 ++ K E+ E E E E DKN+ +E E E + ++S N Sbjct: 106 KKSKVENGNHEEEVEKDEEEEVAEDDEEDKNKQGEEVAEEDEEENKHEEDEIDEQDQSKN 165 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 GD D +T ++ E + + +K Sbjct: 166 AGDTDKDDETLEEEKESGMSENDEK 190 >At4g33740.1 68417.m04790 expressed protein Length = 227 Score = 31.5 bits (68), Expect = 0.33 Identities = 20/85 (23%), Positives = 34/85 (40%), Gaps = 3/85 (3%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAES---STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 76 ++ K E+ E E E E DKN+ +E E E + ++S N Sbjct: 106 KKSKVENGNHEEEVEKDEEEEVAEDDEEDKNKQGEEVAEEDEEENKHEEDEIDEQDQSKN 165 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 GD D +T ++ E + + +K Sbjct: 166 AGDTDKDDETLEEEKESGMSENDEK 190 >At3g60110.1 68416.m06712 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 438 Score = 31.5 bits (68), Expect = 0.33 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = -2 Query: 252 TVEREKSESNKKSREFENKEAESSTYRDKNR-SVNSGSERKSSGKDEEYSEQNSSNKSFN 76 T S + S+E ++ T R KN + ++ +SS D++ E+NS + Sbjct: 262 TATTSARSSRRTSKEIAVVAKDTKTGRAKNNIKKQTDTKTESSDDDDDEKEENSKTEKKT 321 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 D K+++KNS + K+ Sbjct: 322 VADKKKSVADFLKRIKKNSPQKGKE 346 Score = 27.5 bits (58), Expect = 5.3 Identities = 18/90 (20%), Positives = 40/90 (44%), Gaps = 2/90 (2%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQN--SS 91 E++ +++KS ++ R +N + KN+ N G+ +K + ++ S+ N Sbjct: 318 EKKTVADKKKSVADFLKRIKKNSPQKGKETTSKNQKKNDGNVKKENDHQKK-SDGNVKKE 376 Query: 90 NKSFNDGDASADYQTKSKKVEKNSARDKKK 1 N + + K +VE N+++ K Sbjct: 377 NSKVKPRELRSSTGKKKVEVENNNSKSSSK 406 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 31.5 bits (68), Expect = 0.33 Identities = 21/98 (21%), Positives = 44/98 (44%), Gaps = 3/98 (3%) Frame = -2 Query: 285 DRQA*WLEERLTVEREKSESNKKS-REFENKEAESSTYRDKNRSVNSGSE--RKSSGKDE 115 DR+ + E+ +VERE+ + S R + + + + T+ R E R+ S D Sbjct: 218 DREEEYYREKSSVEREEEFKERSSLRSYHSHRSSAHTHSSHRRRSKDREECSREESRSDR 277 Query: 114 EYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 + + ++ + D +SK+ E++ +R + K Sbjct: 278 KERARGMEDR-YGDNKGEVSGSKRSKRSEEDRSRKRHK 314 >At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing protein contains Pfam domain PF03194: LUC7 N_terminus Length = 402 Score = 31.1 bits (67), Expect = 0.43 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 5/82 (6%) Frame = -2 Query: 240 EKSESNK-KSREFENKEAESSTYRDK----NRSVNSGSERKSSGKDEEYSEQNSSNKSFN 76 EK+ K +S+E +KE ESS R+K +R +R+S +D + ++ ++ Sbjct: 311 EKANIRKERSKERNSKERESSKDREKEQETSREHRRDYDRRSRDRDRHHDRDREQDRDYD 370 Query: 75 DGDASADYQTKSKKVEKNSARD 10 + + +++S+ ++ RD Sbjct: 371 RSHSRSRRRSRSRSRSRDRPRD 392 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 31.1 bits (67), Expect = 0.43 Identities = 23/83 (27%), Positives = 40/83 (48%) Frame = -2 Query: 249 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 70 VE+E + + ++K+ +DKNR N K S ++E S+ N S+ S D Sbjct: 734 VEKEDNSDLDANLSCDSKDTIRHQIKDKNRRKN-----KRSSREEVSSDDNGSSDSDVDD 788 Query: 69 DASADYQTKSKKVEKNSARDKKK 1 A + +K EK + +++KK Sbjct: 789 RKEA---KRRRKEEKKTRKEEKK 808 >At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 384 Score = 31.1 bits (67), Expect = 0.43 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 2/82 (2%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVN-SGSERKSSGKDEEYSEQNSSNKSFNDG 70 E EK + +K+ E ENKEAE RDK S+ SE + E +E+ S + D Sbjct: 188 EAEKEKEGEKA-EAENKEAE--VVRDKKESMEVDTSELEKKAGSGEGAEEPSKVEGLKDT 244 Query: 69 D-ASADYQTKSKKVEKNSARDK 7 + A VEK A +K Sbjct: 245 EMKEAQEVVTEADVEKKPAEEK 266 >At1g03530.1 68414.m00334 expressed protein similar to hypothetical protein GB:O14360 Length = 797 Score = 31.1 bits (67), Expect = 0.43 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 79 EKS+ K + E+E+S+ + S +S SE + S +DE E+N + F Sbjct: 233 EKSDEAKGEMDSAESESETSS-SSASSSDSSSSEEEESDEDESDKEENKKEEKF 285 >At5g56360.1 68418.m07034 calmodulin-binding protein similar to alpha glucosidase II beta subunit from GI:2104691 [Mus musculus] Length = 647 Score = 30.7 bits (66), Expect = 0.57 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = -2 Query: 195 EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN---KSFNDGDASADYQTKSKKVE 28 E E ++ D+ N E K+E S ++SS+ +S NDG A + + KKVE Sbjct: 281 EGEPTSILDEATHTNPADEHVVERKEESTSSEDSSSPTDESQNDGSAEKEESDEVKKVE 339 >At5g54910.1 68418.m06839 DEAD/DEAH box helicase, putative Length = 739 Score = 30.7 bits (66), Expect = 0.57 Identities = 18/88 (20%), Positives = 41/88 (46%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EER+ +K + + + E+K+ + R+K R ++ + +DEE E+ + Sbjct: 632 EERMNDYYKKVGAEMRKADIEDKKVDKERRREK-RMKQKIKRKRGAMEDEEEEEEEDHDG 690 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKKK 1 S + D + ++KK+ ++ + K Sbjct: 691 SGSSDDETGRNSKRAKKIVSDNEENGGK 718 >At5g48610.1 68418.m06012 expressed protein ; expression supported by MPSS Length = 470 Score = 30.7 bits (66), Expect = 0.57 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = -2 Query: 210 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 31 EF++K E +DK + G E+KS + ++ ++ K D D + K K Sbjct: 10 EFQDKYKEKKHKKDKEK--REGKEKKSKDRSKDKQKERKEKK-----DKHKDQKDKEKGK 62 Query: 30 EKNSARDKKK 1 EK ++KK Sbjct: 63 EKGKPLEEKK 72 >At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 587 Score = 30.7 bits (66), Expect = 0.57 Identities = 22/69 (31%), Positives = 35/69 (50%) Frame = -2 Query: 300 IIRNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 121 I R++ R + EE L +R K ++ K +FE KEA+ R K R N E + G Sbjct: 20 ITRSKGRNSASPEESLG-KRRKRKTVKLYEDFEEKEAD----RKKKRKGNKEDEDMAEGD 74 Query: 120 DEEYSEQNS 94 D++ E+ + Sbjct: 75 DDQAEEETN 83 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 30.7 bits (66), Expect = 0.57 Identities = 20/70 (28%), Positives = 36/70 (51%) Frame = -2 Query: 210 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 31 E E K E S + K + S SE + + E + + S++ + D ++A+ + ++V Sbjct: 372 EAEPKSNEQSA-KAKEKLSESSSEVVENQQTTEDTTEVSADSASMDDRSNAEQPKEKEEV 430 Query: 30 EKNSARDKKK 1 EK A+D KK Sbjct: 431 EKEKAKDTKK 440 >At1g65090.1 68414.m07379 expressed protein Length = 284 Score = 30.7 bits (66), Expect = 0.57 Identities = 28/97 (28%), Positives = 48/97 (49%), Gaps = 2/97 (2%) Frame = -2 Query: 297 IRNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSER--KSSG 124 IR+E R ER T++ +K N KS E + ++ E + R +G+ + S+G Sbjct: 144 IRDEGRTDKETSER-TLQDDKKSGNAKSEEVQ-EQPEKREAPETRREGETGATKIETSTG 201 Query: 123 KDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSAR 13 KD+E + SSN+ +++ +T K V + AR Sbjct: 202 KDDE---EISSNEVYSEEQLWETMETLRKVVGYSVAR 235 >At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 30.3 bits (65), Expect = 0.75 Identities = 15/98 (15%), Positives = 44/98 (44%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 115 R E W ER+ ++++ + +K ++ +E + ++ +++ E + ++ Sbjct: 396 REERESDRWERERME-QKDRERNKEKDKDHIKREPRTGAEKEISQNEKELGEASAKPSEQ 454 Query: 114 EYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 EY ++ D + +TK K+ E++ + ++ Sbjct: 455 EYVAPEQKKQNEPDNCEKDERETKEKRRERDGDSEAER 492 >At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 30.3 bits (65), Expect = 0.75 Identities = 15/98 (15%), Positives = 44/98 (44%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 115 R E W ER+ ++++ + +K ++ +E + ++ +++ E + ++ Sbjct: 396 REERESDRWERERME-QKDRERNKEKDKDHIKREPRTGAEKEISQNEKELGEASAKPSEQ 454 Query: 114 EYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 EY ++ D + +TK K+ E++ + ++ Sbjct: 455 EYVAPEQKKQNEPDNCEKDERETKEKRRERDGDSEAER 492 >At3g48120.1 68416.m05248 expressed protein Length = 328 Score = 30.3 bits (65), Expect = 0.75 Identities = 21/87 (24%), Positives = 46/87 (52%), Gaps = 4/87 (4%) Frame = -2 Query: 249 VEREKSESNKKSREFENK--EAESSTYRDKNRSVNSGSERKS-SGKDEEYSEQNSSNKSF 79 V+RE+ S +S E N+ + ES +++RS++ ER+S E+ + + K + Sbjct: 126 VDRERRRSRSRSAERRNRYGDRESRRRSNRSRSLSPRRERRSREDVKEKKPDYSRLIKGY 185 Query: 78 NDGDASADYQTKSK-KVEKNSARDKKK 1 ++ A+ + K K ++++ + +D K Sbjct: 186 DEMSAAEKVKAKMKLQLDETAEKDTSK 212 Score = 29.9 bits (64), Expect = 1.00 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTY--RDKNRSVNSGSERKSSGKDEEYSEQNSS 91 E R RE+ E +K R S+Y R++ RS + +ER++ D E +++ Sbjct: 96 ERRRYRSRERDERDKSHRRRSRSSERRSSYVDRERRRSRSRSAERRNRYGDRESRRRSNR 155 Query: 90 NKSFN 76 ++S + Sbjct: 156 SRSLS 160 >At2g44430.1 68415.m05525 DNA-binding bromodomain-containing protein contains Pfam domains, Pfam PF00439: Bromodomain and PF00249: Myb-like DNA-binding domain Length = 646 Score = 30.3 bits (65), Expect = 0.75 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 1/87 (1%) Frame = -2 Query: 267 LEERLTVEREKSE-SNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 91 LEE V EK + N++ E + S +R+K S S+R++ +E S + Sbjct: 165 LEEEREVGEEKPDLENERKEERSENDGSESEHREKAVSAAEESDRENRSMNESNSTATAG 224 Query: 90 NKSFNDGDASADYQTKSKKVEKNSARD 10 + GD + + +KN D Sbjct: 225 EEERVCGDEPSQTREDDSGNDKNPDPD 251 >At1g74830.1 68414.m08670 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593 Length = 542 Score = 30.3 bits (65), Expect = 0.75 Identities = 21/74 (28%), Positives = 36/74 (48%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 115 R D QA + +E L + SE K+ E + EAE YR+K + + + E Sbjct: 360 RMMDEQAEYDQEAL--QSMSSELAKREEEMKELEAEFEVYREKYGCLTDQEDAR-----E 412 Query: 114 EYSEQNSSNKSFND 73 E+ +QN + +++D Sbjct: 413 EFHKQNGNASAYDD 426 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 30.3 bits (65), Expect = 0.75 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 4/92 (4%) Frame = -2 Query: 267 LEERLTVEREKSESNKKSREFENKEAESSTYR--DKNRSVNSGSERKS--SGKDEEYSEQ 100 ++E L R + ++ + E K+ SST + +K RS NS S K S +DE+ SEQ Sbjct: 691 MQEALEQSRTEMKAKLSASSSERKDLLSSTRQRAEKFRSFNSRSSMKKYQSEEDEDISEQ 750 Query: 99 NSSNKSFNDGDASADYQTKSKKVEKNSARDKK 4 K D +A Q + S++ +K Sbjct: 751 KPRAK-----DKAASGQQSVGSISSRSSQARK 777 >At1g69070.1 68414.m07903 expressed protein Length = 901 Score = 30.3 bits (65), Expect = 0.75 Identities = 24/90 (26%), Positives = 37/90 (41%) Frame = -2 Query: 270 WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 91 W+++ L ERE + N +S E E+ E+E D + + G E++ G E EQ+ Sbjct: 343 WIDDVL--EREDNVDNSESDEDEDSESEEE--EDDDGESDGGDEKQRKGHHLEDWEQSDD 398 Query: 90 NKSFNDGDASADYQTKSKKVEKNSARDKKK 1 D D + E R KK Sbjct: 399 ELGAELEDEEEDDDEEDDDEEDAELRVHKK 428 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 30.3 bits (65), Expect = 0.75 Identities = 19/106 (17%), Positives = 44/106 (41%) Frame = -2 Query: 318 RDRNQ*IIRNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 139 +D N+ R +DR E+ +REKS + RE +RD++R + Sbjct: 60 KDGNKDRDREKDRDR---EKSRDRDREKSRDRDRDRERSKDRQRDRHHRDRHRDRSRERS 116 Query: 138 RKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 K D+++ ++ D + + + + ++ +R +++ Sbjct: 117 EKRDDLDDDHHRRSRDRDRRRSRDRDREVRHRRRSRSRSRSRSERR 162 >At5g66950.1 68418.m08440 expressed protein Length = 870 Score = 29.9 bits (64), Expect = 1.00 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 E RL REKS+ N R N++ S R RSV+ G S DE+ E S+ Sbjct: 624 EFRLLGRREKSQYNG-GRLLVNEDEHPSKRRVSFRSVDHGEASVISLGDEDEEEDGSNGV 682 Query: 84 SFND 73 ++D Sbjct: 683 EWDD 686 >At5g62750.1 68418.m07877 expressed protein predicted proteins, Caenorhabditis elegans Length = 124 Score = 29.9 bits (64), Expect = 1.00 Identities = 18/76 (23%), Positives = 34/76 (44%) Frame = -2 Query: 231 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADY 52 E+ +K + +NKE E + ++ ++ KD+ ++N + D + + Sbjct: 3 ETEEKVKNHDNKEEE---HNKAEKAEKKEKKKDKDKKDKNEDDKNGGGEEGEDQEKKSKK 59 Query: 51 QTKSKKVEKNSARDKK 4 + K K EKN DKK Sbjct: 60 KDKKAKKEKN-PEDKK 74 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 29.9 bits (64), Expect = 1.00 Identities = 15/65 (23%), Positives = 27/65 (41%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 64 R++ +++ R + ++ S Y + S ER + +Q+ K DG Sbjct: 367 RDRDRDHERDRTHDREKDRSRDYYHDGKRSKSDRERDNDRDVSRLDDQSGRYKDRRDGRR 426 Query: 63 SADYQ 49 S DYQ Sbjct: 427 SPDYQ 431 Score = 29.5 bits (63), Expect = 1.3 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 6/86 (6%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSER------KSSGKDEEYSEQNSSNKSF 79 E + S+ K R+ ++ E+ S + K+ S++ KS +DE E+ + Sbjct: 67 EYTSSSSKRRKGKSGESGSDRWNGKDDDKGESSKKTKVSSEKSRKRDEGDGEETKKSSGK 126 Query: 78 NDGDASADYQTKSKKVEKNSARDKKK 1 +DG + +SK V+K R K+ Sbjct: 127 SDGKHRESSRRESKDVDKEKDRKYKE 152 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 29.9 bits (64), Expect = 1.00 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Frame = -2 Query: 255 LTVEREKSES-NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY---SEQNSSN 88 L++E EK ES NKK R + E S + +S + G K DEE E Sbjct: 1531 LSLEHEKVESRNKKRRSSALPKTEYSGEAGEEKSESEGKSLKEGEDDEEVVNKEEDLQEA 1590 Query: 87 KSFNDGDA 64 K+ + GDA Sbjct: 1591 KTESSGDA 1598 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 29.9 bits (64), Expect = 1.00 Identities = 22/88 (25%), Positives = 42/88 (47%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EE T ++S+SN + + E + + S +SGSER+S DE + S Sbjct: 432 EETATDSDDESDSNSEKDQEEEQSQLEKARESSSSSSDSGSERRSI--DETNATAQSLKI 489 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKKK 1 S++ + S++ + K K+S + ++ Sbjct: 490 SYS--NYSSEEEDNEKLSSKSSCKSNEE 515 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 E+ E+E+ ++KK +E E +S D N + E+ K E S +S + Sbjct: 412 EKEQKAEKEEESTSKKRQEQEETATDSDDESDSNSEKDQEEEQSQLEKARESSSSSSDSG 471 Query: 84 S 82 S Sbjct: 472 S 472 >At4g02720.1 68417.m00368 expressed protein temporary automated functional assignment Length = 422 Score = 29.9 bits (64), Expect = 1.00 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 2/83 (2%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSE--RKSSGKDEEYSEQNSSNKSFNDG 70 R+K +KS +F E S RD+N + ++ + +G + + + + K +D Sbjct: 45 RQKRLKMRKSAKFCFWENTPSPPRDQNEDSDENADEIQDKNGGERDDNSKGKERKGKSDS 104 Query: 69 DASADYQTKSKKVEKNSARDKKK 1 ++ +D +S+K + S+R K++ Sbjct: 105 ESESD-GLRSRKRKSKSSRSKRR 126 >At3g59990.2 68416.m06698 methionyl aminopeptidase, putative / methionine aminopeptidase, putative / peptidase M, putative similar to Methionine aminopeptidase 2 (EC 3.4.11.18) from {Rattus norvegicus} SP|P38062, {Homo sapiens} SP|P50579; contains Pfam profile PF00557: metallopeptidase family M24; supporting cDNA gi|11344921|gb|AF300880.1|AF300880 Length = 439 Score = 29.9 bits (64), Expect = 1.00 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 7/59 (11%) Frame = -2 Query: 156 VNSGSERKSSGKDEEYSEQNSSNKSF-------NDGDASADYQTKSKKVEKNSARDKKK 1 V +G S+GK+E+ + S NDG+ + +T +KK +K + KKK Sbjct: 15 VENGGAESSNGKEEQLESELSKKLEIAEDGQEENDGEEGSKAETSTKKKKKKNKSKKKK 73 >At3g59990.1 68416.m06697 methionyl aminopeptidase, putative / methionine aminopeptidase, putative / peptidase M, putative similar to Methionine aminopeptidase 2 (EC 3.4.11.18) from {Rattus norvegicus} SP|P38062, {Homo sapiens} SP|P50579; contains Pfam profile PF00557: metallopeptidase family M24; supporting cDNA gi|11344921|gb|AF300880.1|AF300880 Length = 439 Score = 29.9 bits (64), Expect = 1.00 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 7/59 (11%) Frame = -2 Query: 156 VNSGSERKSSGKDEEYSEQNSSNKSF-------NDGDASADYQTKSKKVEKNSARDKKK 1 V +G S+GK+E+ + S NDG+ + +T +KK +K + KKK Sbjct: 15 VENGGAESSNGKEEQLESELSKKLEIAEDGQEENDGEEGSKAETSTKKKKKKNKSKKKK 73 >At4g24590.1 68417.m03523 expressed protein Length = 241 Score = 29.5 bits (63), Expect = 1.3 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -2 Query: 150 SGSERKSSGKDEEYSEQNSSNKSFND-GDASAD--YQTKSKKVEKNSARDK 7 +G E+ S ++EE E + S +D GD AD Y +VE N R+K Sbjct: 52 NGGEQSESPEEEEEEESDREEPSASDPGDPEADKFYDLIKSRVECNDFREK 102 >At4g00990.1 68417.m00133 transcription factor jumonji (jmjC) domain-containing protein contains Pfam domain, PF02373: jmjC domain Length = 840 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/71 (23%), Positives = 37/71 (52%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 +++ +E+ + +++ + E+S +N+S+ E K KD+ +E+ S+N S G Sbjct: 576 QKKYAEAMLQKQQYSGQVKEASEL--ENKSMKEVDESKKDLKDKAANEEQSNNSSRPSGS 633 Query: 66 ASADYQTKSKK 34 A+ SK+ Sbjct: 634 GEAEKVIISKE 644 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVN-SGSERKSSGKDEEYSEQNSSN 88 E + E E+ + K +EFE ++ + RD++ G++ + G+ +E + N Sbjct: 144 ENQTVQESEEGQMKKVVKEFEKEQKQQ---RDEDAGTQPKGTQGQEQGQGKEQPDVEQGN 200 Query: 87 KSFNDGDASAD 55 K + D++ D Sbjct: 201 KQGQEQDSNTD 211 >At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 371 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 ERE+ E+ +K++ NKEAE+ T + + S E +D++ + + ++ + Sbjct: 296 EREQEETEQKAK---NKEAEAGTSKSSGDAEQSSKEVNEEEEDDDDDDDDLDMDELDELE 352 Query: 66 AS 61 AS Sbjct: 353 AS 354 Score = 27.5 bits (58), Expect = 5.3 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 210 EFEN-KEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 E+E +E E + + KN+ +G+ KSSG E+ S++ + + +D D Sbjct: 292 EYEREREQEETEQKAKNKEAEAGTS-KSSGDAEQSSKEVNEEEEDDDDD 339 >At2g12875.1 68415.m01402 hypothetical protein Length = 325 Score = 29.5 bits (63), Expect = 1.3 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 5/84 (5%) Frame = -2 Query: 237 KSESNKKSREFENK--EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 64 K+ + + S +NK EA DKN S + + ++EE SE+ + +DG+ Sbjct: 92 KATTEEPSSTEQNKAIEAVKEDKYDKNEEEKSEKDEQEKSEEEE-SEEEEKEEGNDDGEE 150 Query: 63 SADYQTKSKK---VEKNSARDKKK 1 S++ T +++ E+ S+ ++ K Sbjct: 151 SSNDSTTTEEPSSTEEPSSSEQNK 174 >At1g76770.1 68414.m08934 heat shock protein-related contains similarity to 17.9 kDa heat-shock protein [Helianthus annuus] gi|11990130|emb|CAB55634 Length = 244 Score = 29.5 bits (63), Expect = 1.3 Identities = 21/60 (35%), Positives = 26/60 (43%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EE+ E E E K E EN+EAE ++ V G+ R GK EE E K Sbjct: 156 EEKTEPEEEIKEETKP--EEENEEAEEPQREEEEEVVEEGT-RDHEGKKEEEIEDKPRKK 212 >At1g65470.1 68414.m07427 chromatin assembly factor-1 (FASCIATA1) (FAS1) identical to FAS1 [Arabidopsis thaliana] GI:4887626 Length = 815 Score = 29.5 bits (63), Expect = 1.3 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = -2 Query: 267 LEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 103 L+E+L E+E+ K + NKE E + R + + SE++ +++E +E Sbjct: 271 LKEKLQQEKEQKLLQKAIVDENNKEKEETESRKRIKKQQDESEKEQKRREKEQAE 325 >At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related similar to U2 small nuclear ribonucleoprotein auxiliary factor 35 kD subunit related protein 1 (sp|Q15695) Length = 757 Score = 29.5 bits (63), Expect = 1.3 Identities = 23/98 (23%), Positives = 41/98 (41%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 115 R +++ EE RE E +K E E + E R K+ + + ++SG DE Sbjct: 84 RRREKELKDFEESERAWREAMEIKRKKEEEEEAKREEEERRWKD--LEELRKLEASGNDE 141 Query: 114 EYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 +++ + +G +Q ++KN R KK Sbjct: 142 CGEDEDGEYEYIEEGPPEIIFQGNEIILKKNKVRVPKK 179 >At5g64030.1 68418.m08039 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 829 Score = 29.1 bits (62), Expect = 1.7 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGS-ERKSSGKDEEYSEQNSSNKSFNDG 70 + E ++N+K + E ++ E + + S + E+KS D++ S+ + NK+ N+ Sbjct: 162 DEENPDTNEKQTKPETEDNELGEDGENQKQFESDNGEKKSIDDDKKSSDDDKENKTGNE- 220 Query: 69 DASADYQTKSKK 34 D +TK++K Sbjct: 221 ----DTETKTEK 228 >At4g25880.2 68417.m03722 pumilio/Puf RNA-binding domain-containing protein contains Pfam profile:PF00806 Pumilio-family RNA binding domains Length = 852 Score = 29.1 bits (62), Expect = 1.7 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 6/82 (7%) Frame = -2 Query: 258 RLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS------ERKSSGKDEEYSEQN 97 +L+ +E SE + N ++ + D S S S + SSG+ ++S N Sbjct: 121 KLSTHKEVSEDESSQQLSVNSVSDRTDGLDIRLSPGSQSLADFRQDDTSSGQTPQHSRSN 180 Query: 96 SSNKSFNDGDASADYQTKSKKV 31 SSN N D S ++ S V Sbjct: 181 SSNGEVNTADESGNFSELSDDV 202 >At4g25880.1 68417.m03721 pumilio/Puf RNA-binding domain-containing protein contains Pfam profile:PF00806 Pumilio-family RNA binding domains Length = 861 Score = 29.1 bits (62), Expect = 1.7 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 6/82 (7%) Frame = -2 Query: 258 RLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS------ERKSSGKDEEYSEQN 97 +L+ +E SE + N ++ + D S S S + SSG+ ++S N Sbjct: 121 KLSTHKEVSEDESSQQLSVNSVSDRTDGLDIRLSPGSQSLADFRQDDTSSGQTPQHSRSN 180 Query: 96 SSNKSFNDGDASADYQTKSKKV 31 SSN N D S ++ S V Sbjct: 181 SSNGEVNTADESGNFSELSDDV 202 >At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calreticulin (crt1) GI:2052379 [Arabidopsis thaliana] Length = 425 Score = 29.1 bits (62), Expect = 1.7 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -2 Query: 231 ESNKKSREFENKEA--ESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 58 E+ KK E E+K+A ES + N G + + K EE E + K + DA+ Sbjct: 364 EAEKKREEEESKDAPAESDAEEEAEDDDNEGDDSDNESKSEETKEAEET-KEAEETDAAH 422 Query: 57 D 55 D Sbjct: 423 D 423 >At1g29470.1 68414.m03605 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 29.1 bits (62), Expect = 1.7 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 8/86 (9%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFEN---KEAESSTYRDKNRSVNSGSERKS---SGKDEEY-- 109 EER + + + ++K+ + E E++ + ++K + S E KS +G +E Sbjct: 115 EERKEFDDKNGDGDRKNGDGEKDTESESDETKQKEKTQLEESSEENKSEDSNGTEENAGE 174 Query: 108 SEQNSSNKSFNDGDASADYQTKSKKV 31 SE+N+ KS + + + KSK V Sbjct: 175 SEENTEKKSEENAGETEESTEKSKDV 200 >At1g08600.1 68414.m00953 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|P46100 Transcriptional regulator ATRX {Homo sapiens}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain; non-consensus GC donor splice site at exon boundary 28614 Length = 1457 Score = 29.1 bits (62), Expect = 1.7 Identities = 19/73 (26%), Positives = 39/73 (53%) Frame = -2 Query: 261 ERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 82 +RLT+E EK+ +KKS E + + S+ N SV++ ++ + ++ S++ + Sbjct: 547 QRLTLELEKAMRDKKSIELSSDSSSDSS--SDNNSVDTDADVNVTISSKKKSKK-KIRRI 603 Query: 81 FNDGDASADYQTK 43 +D + D +TK Sbjct: 604 IDDAELGKDTRTK 616 >At5g64910.1 68418.m08165 expressed protein ; expression supported by MPSS Length = 487 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/83 (19%), Positives = 30/83 (36%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 E+++ + E + EN+E E++ K E K+EE E +K Sbjct: 53 EDKVESPAPEEEGKNEEEANENQEEEAAKVESKAAEEGGNEEEAKEDKEEEKEEAAREDK 112 Query: 84 SFNDGDASADYQTKSKKVEKNSA 16 + D K+ K ++ Sbjct: 113 EEEEEAVKPDESASQKEEAKGAS 135 >At5g38840.1 68418.m04698 forkhead-associated domain-containing protein / FHA domain-containing protein related to adaptor protein kanadaptin [Homo sapiens] gi|13562130|gb|AAK29177 Length = 735 Score = 28.7 bits (61), Expect = 2.3 Identities = 25/92 (27%), Positives = 40/92 (43%) Frame = -2 Query: 300 IIRNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGK 121 I RNE R A LEE +E ++S ++S K T+ K + + E SS + Sbjct: 319 IARNEQRTAELLEELENLEETLNDSIRES--LGAKTGRKPTH-GKKKGIVEDEEDLSSDE 375 Query: 120 DEEYSEQNSSNKSFNDGDASADYQTKSKKVEK 25 D+ Y ++ S G + +T V+K Sbjct: 376 DDFY-DRTQKKPSTKKGSENQTVETVDSLVDK 406 >At3g62620.1 68416.m07034 sucrose-phosphatase-related contains weak similarity to sucrose-phosphatase [Arabidopsis thaliana] gi|11127757|gb|AAG31075 Length = 358 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 1/80 (1%) Frame = -2 Query: 237 KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 58 K++ NKK + + + A S + K + K +GK + + +S K D S Sbjct: 126 KTKGNKKKKTKKQELASDSISKPKLLTEKPEVSWKVNGKKKTEANASSPAKDATDSKVSF 185 Query: 57 DYQTK-SKKVEKNSARDKKK 1 TK S +V+ ++ +KK Sbjct: 186 SKPTKSSSQVQDQKSKSQKK 205 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/74 (24%), Positives = 33/74 (44%), Gaps = 4/74 (5%) Frame = -2 Query: 264 EERLTVERE----KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQN 97 +E +T+E++ + E +K E E KE + S R+K + K GK+++ E + Sbjct: 520 KEIITLEKQVKLLEEEEKEKREEEERKEKKRSKEREKKLRKKERLKEKDKGKEKKNPECS 579 Query: 96 SSNKSFNDGDASAD 55 + N D Sbjct: 580 DKDMLLNSSREEED 593 >At2g30060.1 68415.m03656 Ran-binding protein 1b (RanBP1b) nearly identical to atranbp1b [Arabidopsis thaliana] GI:2058284 Length = 217 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -2 Query: 267 LEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNS 148 L E+LTVE ++SE + ENK++E+ + SV S Sbjct: 177 LLEKLTVEEKESEKKPVEKAEENKKSEAVEEKKTEESVPS 216 >At2g25190.1 68415.m03012 expressed protein Length = 240 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = -2 Query: 204 ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEK 25 E E+E R+++RS S SS + + + S N +S+ + SKK + Sbjct: 166 ELSESEKKKLRNRSRSDPLLSSSPSSSTPDNHRSHIRAKSSGNHPSSSSSSSSGSKKNRR 225 Query: 24 NSARDKK 4 A+D+K Sbjct: 226 PKAQDQK 232 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSER---KSSGKDEEYSEQNSSNKSFND 73 +E S S + + E++ +E + V S +E+ K KDEE E+N + K+ Sbjct: 4545 KEYSVSEDEEEDKEDEGSEDEPLDNGIGDVGSDAEKADEKPWNKDEEDEEENMNEKN-ES 4603 Query: 72 GDASADYQTKSKKV 31 G + D T+S+++ Sbjct: 4604 GPSIVDKDTRSREL 4617 >At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 327 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = -2 Query: 261 ERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 103 +R T++ + + S +A SS R+ RS + GSER+ GK++E+ E Sbjct: 266 DRFTLQLPEEVRRQLSHMKTLPQARSS--REGYRSGSVGSERRGKGKEKEFGE 316 >At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:1000090) [Gossypium barbadense] Length = 335 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 4/83 (4%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG-- 70 +E+ +N K+ E N + S+ + + E K E Y + +N+ FN+ Sbjct: 98 KEEFNNNNKNDEKVNSKTFSTPSLSETEESFNNYEENYPKKTENYGTKGYNNEEFNNNNN 157 Query: 69 --DASADYQTKSKKVEKNSARDK 7 DA+ + + K ++N A+++ Sbjct: 158 KYDANFKEEFNNNKYDENYAKEE 180 >At1g01440.1 68414.m00059 extra-large G-protein-related weak similarity to extra-large G-protein (AtXLG1) (GI:3201682) [Arabidopsis thaliana] Length = 664 Score = 28.7 bits (61), Expect = 2.3 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 6/72 (8%) Frame = -2 Query: 234 SESNKKSREFENKEAESSTYRDKNRSVNS----GSER--KSSGKDEEYSEQNSSNKSFND 73 S + + R F+ ES+T +NR +S GS+R KSS K+EE +SS+K+ Sbjct: 14 SSRSDEDRGFKEDLNESATSPMRNRLDDSNSRPGSQRFVKSSRKEEETDSDSSSSKNTTT 73 Query: 72 GDASADYQTKSK 37 + Y K + Sbjct: 74 RNNPIQYTDKQQ 85 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 28.3 bits (60), Expect = 3.0 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -3 Query: 119 TRSTVNRTPVINPLTTAMHRLTTKPNLRRLKRILPE 12 T S R P I P T A +RLT PN R LK L E Sbjct: 3 TSSRSERFP-ITPSTAATNRLTITPNSRVLKSPLTE 37 >At5g65490.1 68418.m08236 expressed protein similar to unknown protein (dbj BAA75199.1) Length = 643 Score = 28.3 bits (60), Expect = 3.0 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSV---NSGSERKSSGKD--EEYSEQNSSNKSF 79 +E S+ S ++ ++ +S +++ + + NS ERK+ GK+ E S +++ +F Sbjct: 398 QEVPASDNDSWLYDGEDELNSVLQERQKEMEFYNSKKERKNKGKEKQEAGSSSDANMNNF 457 Query: 78 NDGDASADYQTKSKKV 31 + GD S Q KV Sbjct: 458 DLGDISKSMQQFMHKV 473 >At5g51410.2 68418.m06374 LUC7 N_terminus domain-containing protein similar to cisplatin resistance-associated overexpressed protein [Homo sapiens] GI:6899846; contains Pfam profile PF03194: LUC7 N_terminus Length = 334 Score = 28.3 bits (60), Expect = 3.0 Identities = 17/79 (21%), Positives = 33/79 (41%) Frame = -2 Query: 237 KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 58 K + ++ R KEA+ + K R S S+R S E Y +++ + D Sbjct: 236 KDKGKEEERLVRGKEADD---KRKPREKESESKRSGSSDRERYRDRDRNRDGDRHRDRGR 292 Query: 57 DYQTKSKKVEKNSARDKKK 1 DY+ + ++ D+ + Sbjct: 293 DYRKPYDRRSRSGREDRDR 311 >At5g51410.1 68418.m06373 LUC7 N_terminus domain-containing protein similar to cisplatin resistance-associated overexpressed protein [Homo sapiens] GI:6899846; contains Pfam profile PF03194: LUC7 N_terminus Length = 334 Score = 28.3 bits (60), Expect = 3.0 Identities = 17/79 (21%), Positives = 33/79 (41%) Frame = -2 Query: 237 KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 58 K + ++ R KEA+ + K R S S+R S E Y +++ + D Sbjct: 236 KDKGKEEERLVRGKEADD---KRKPREKESESKRSGSSDRERYRDRDRNRDGDRHRDRGR 292 Query: 57 DYQTKSKKVEKNSARDKKK 1 DY+ + ++ D+ + Sbjct: 293 DYRKPYDRRSRSGREDRDR 311 >At5g44690.1 68418.m05476 hypothetical protein Length = 684 Score = 28.3 bits (60), Expect = 3.0 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKK---SREFENKEAESSTYRDKNRSVNSGSERKSSG 124 RNE+R+ EE ++E E+ SN + S ++E + T R R SG E KSS Sbjct: 369 RNEERRK--KEEGKSMEIEEYRSNPQEVTSVVCLDREKDEETARQVFRE--SGKEEKSSQ 424 Query: 123 KDEEYSE 103 DEE S+ Sbjct: 425 NDEETSK 431 >At5g10660.1 68418.m01234 calmodulin-binding protein-related contains weak similarity to calmodulin-binding proteins Length = 407 Score = 28.3 bits (60), Expect = 3.0 Identities = 21/84 (25%), Positives = 36/84 (42%) Frame = -2 Query: 267 LEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 88 L ++ V REK + +S F +S S R SSG + NSS+ Sbjct: 115 LRDKPAVPREKPVTGLRSTSFHGSSRGGLRGSSTVKSPPVAS-RGSSGVKKSGLSGNSSS 173 Query: 87 KSFNDGDASADYQTKSKKVEKNSA 16 KS +G + ++ K++ +S+ Sbjct: 174 KSKKEGSGNVPKKSSGKEISPDSS 197 >At4g30935.1 68417.m04392 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 466 Score = 28.3 bits (60), Expect = 3.0 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 7/85 (8%) Frame = -2 Query: 267 LEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE-------RKSSGKDEEY 109 +EE ++ K+ + +KS + E ++ S +RD+ +S+ + E R++ GKD+ Sbjct: 1 MEEDTGIDEAKTYTVEKSEKVEPEKDGLSQFRDEEKSLGADMEDLHDETVRETLGKDQVQ 60 Query: 108 SEQNSSNKSFNDGDASADYQTKSKK 34 + +S+ N D +T S K Sbjct: 61 GVRENSSVEPNVEDVLEVNETDSVK 85 >At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptidyl-prolyl cis-trans isomerase-related immunophilin FKBP46 - Spodoptera frugiperda (fall armyworm),PIR2:A55320 Length = 477 Score = 28.3 bits (60), Expect = 3.0 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 19/106 (17%) Frame = -2 Query: 261 ERLTVEREKSESNKK----------SREFENKEAESSTYRDKNRSVN-----SGSERKSS 127 E++ V+ ++ SNKK +E NK + ++K + N +G + + Sbjct: 233 EKMVVDNDEQGSNKKRKAKAAEQDDGQESANKSKKKKNQKEKKKGENVLNEEAGQVQTGN 292 Query: 126 GKDEEYSEQNSSNKSFNDGDA----SADYQTKSKKVEKNSARDKKK 1 ++ Q SSN DG A S +T K EK + KKK Sbjct: 293 VLKKQDISQISSNTKAQDGTANNAMSESSKTPDKSAEKKTKNKKKK 338 >At4g24580.1 68417.m03522 pleckstrin homology (PH) domain-containing protein-related / RhoGAP domain-containing protein contains Pfam domain, PF00620: RhoGAP domain Length = 902 Score = 28.3 bits (60), Expect = 3.0 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 153 NSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSAR 13 + GS+ DEE +N SN S+++ AS D S + + AR Sbjct: 445 DDGSQGSEDYTDEEEDLENESNGSYSESAASEDKYADSIDPDDHKAR 491 >At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 698 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/82 (19%), Positives = 35/82 (42%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 + + E + E ++ E S ++NR + +S+ DEEY + +KS+ + Sbjct: 541 DEDDEEGDDDFHEPDSDEDLSDNNDERNRDEIGSVDEESTKSDEEYDDLAMEDKSYWTDN 600 Query: 66 ASADYQTKSKKVEKNSARDKKK 1 + + V +N+ + K Sbjct: 601 EEEESRDTISMVSQNNHNEASK 622 >At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 717 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/82 (19%), Positives = 35/82 (42%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 + + E + E ++ E S ++NR + +S+ DEEY + +KS+ + Sbjct: 560 DEDDEEGDDDFHEPDSDEDLSDNNDERNRDEIGSVDEESTKSDEEYDDLAMEDKSYWTDN 619 Query: 66 ASADYQTKSKKVEKNSARDKKK 1 + + V +N+ + K Sbjct: 620 EEEESRDTISMVSQNNHNEASK 641 >At3g27700.2 68416.m03459 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 908 Score = 28.3 bits (60), Expect = 3.0 Identities = 21/90 (23%), Positives = 34/90 (37%) Frame = -2 Query: 270 WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 91 W E L + +SN++S N S RD S N + + K + +S+ Sbjct: 791 WQEHTLQLVWVTRQSNRESNNNNNNSNSLSVSRDNLSSKNKCASVSNDPKPAVEVKTSST 850 Query: 90 NKSFNDGDASADYQTKSKKVEKNSARDKKK 1 + N + + T K+ K S D K Sbjct: 851 EEPENTNVSGDNDSTLDKQETKESDNDNNK 880 >At3g27700.1 68416.m03458 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 908 Score = 28.3 bits (60), Expect = 3.0 Identities = 21/90 (23%), Positives = 34/90 (37%) Frame = -2 Query: 270 WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 91 W E L + +SN++S N S RD S N + + K + +S+ Sbjct: 791 WQEHTLQLVWVTRQSNRESNNNNNNSNSLSVSRDNLSSKNKCASVSNDPKPAVEVKTSST 850 Query: 90 NKSFNDGDASADYQTKSKKVEKNSARDKKK 1 + N + + T K+ K S D K Sbjct: 851 EEPENTNVSGDNDSTLDKQETKESDNDNNK 880 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.3 bits (60), Expect = 3.0 Identities = 19/79 (24%), Positives = 30/79 (37%), Gaps = 4/79 (5%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS----EQNSSNKSF 79 E+EK E + R EN + + + S+RKS + S S Sbjct: 795 EKEKEEERSRHRRAENSSKDKRRRSPTSNESSDDSKRKSRSRRRSVSPSPVRSRRKRSSP 854 Query: 78 NDGDASADYQTKSKKVEKN 22 + ++S D + KS KN Sbjct: 855 SSDESSDDSKRKSSSKRKN 873 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 3.0 Identities = 19/79 (24%), Positives = 30/79 (37%), Gaps = 4/79 (5%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS----EQNSSNKSF 79 E+EK E + R EN + + + S+RKS + S S Sbjct: 765 EKEKEEERSRHRRAENSSKDKRRRSPTSNESSDDSKRKSRSRRRSVSPSPVRSRRKRSSP 824 Query: 78 NDGDASADYQTKSKKVEKN 22 + ++S D + KS KN Sbjct: 825 SSDESSDDSKRKSSSKRKN 843 >At1g69220.2 68414.m07926 serine/threonine protein kinase, putative identical to serine/threonine kinase [Arabidopsis thaliana] gi|2352084|gb|AAB68776 Length = 809 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = -2 Query: 189 ESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARD 10 ++S Y K R + R++ G DEE S++ + +D D K +K +D Sbjct: 122 KNSPYSSKPR-MGVSPRRRARGGDEESSDEEDEEEDDDDDDGDYGTFVVKSKDKKGKKKD 180 Query: 9 KK 4 K+ Sbjct: 181 KE 182 >At1g69220.1 68414.m07925 serine/threonine protein kinase, putative identical to serine/threonine kinase [Arabidopsis thaliana] gi|2352084|gb|AAB68776 Length = 836 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = -2 Query: 189 ESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARD 10 ++S Y K R + R++ G DEE S++ + +D D K +K +D Sbjct: 122 KNSPYSSKPR-MGVSPRRRARGGDEESSDEEDEEEDDDDDDGDYGTFVVKSKDKKGKKKD 180 Query: 9 KK 4 K+ Sbjct: 181 KE 182 >At1g32150.1 68414.m03955 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 389 Score = 28.3 bits (60), Expect = 3.0 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREF-ENKEAESSTYRDKN----RSVNSGSERKSSGKDEEYSEQ 100 +E+L ++R K + +N EA ++ N +S SGS+ S G D Sbjct: 145 KEKLPIKRSKGSLGSLNMIIGKNNEAGKNSGASANGACSKSAESGSDGSSDGSDANSQND 204 Query: 99 NSSNKSFNDGDASAD 55 + S + DG+ +++ Sbjct: 205 SGSRHNGKDGETASE 219 >At1g21390.1 68414.m02676 expressed protein Length = 248 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -2 Query: 219 KSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 106 + +E+ N+ +ESST R + S N+ +SS +DE+ S Sbjct: 185 EDKEWWNRMSESSTKRSGSSSSNNSIRSRSSLRDEKSS 222 >At1g17820.1 68414.m02206 expressed protein Length = 803 Score = 28.3 bits (60), Expect = 3.0 Identities = 18/51 (35%), Positives = 22/51 (43%) Frame = -2 Query: 267 LEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 115 LEE T S SNK+ E S + +RSV S E S GK + Sbjct: 714 LEELKTPLLVPSSSNKQETNSRGSSREVSAVQSPSRSVASSEEDDSRGKKQ 764 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 28.3 bits (60), Expect = 3.0 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 13/84 (15%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNR-------SVNSGSERKSSGKDE-----EYSEQ- 100 E+ S E E +E E RDK R S NSG R S ++E EY +Q Sbjct: 471 EEGGSEYGGYEDETQEKEEKPSRDKERATTERDWSENSGDRRHKSHREEKDSHREYKQQR 530 Query: 99 NSSNKSFNDGDASADYQTKSKKVE 28 + + F+ G +S +++S+ E Sbjct: 531 DRDSDEFDRGQSSLKSRSRSRMSE 554 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 27.9 bits (59), Expect = 4.0 Identities = 16/60 (26%), Positives = 31/60 (51%) Frame = -2 Query: 261 ERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 82 E+L ++R + + + E E K++ES T DK+ + S+ +S + ++ NKS Sbjct: 312 EKLNLDRSSGDESMED-EPETKQSESITSDDKSAKIEMLSKEESRADMDAGKGKSPENKS 370 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/76 (18%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -2 Query: 234 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD 55 +++N + N + + +D N + N+ + ++G D + N +N N+ + Sbjct: 82 NDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNNNQNNGGG 141 Query: 54 YQTKS-KKVEKNSARD 10 +S +NS R+ Sbjct: 142 SNNRSPPPPSRNSDRN 157 >At2g44200.1 68415.m05500 expressed protein Length = 493 Score = 27.9 bits (59), Expect = 4.0 Identities = 17/92 (18%), Positives = 37/92 (40%) Frame = -2 Query: 288 EDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 109 E R + + R ++ + +E + +E + S ++ ER+ S D+E Sbjct: 244 ESRDRHYEKRRSELDDGHKRRERHDTHYERRRSEMDDESKRRESRDNHYERRRSDLDDES 303 Query: 108 SEQNSSNKSFNDGDASADYQTKSKKVEKNSAR 13 + S +K F + D + K ++ + R Sbjct: 304 KRRESHDKHFERQRSDLDDEYKRRESQDKRRR 335 Score = 27.1 bits (57), Expect = 7.0 Identities = 14/75 (18%), Positives = 32/75 (42%) Frame = -2 Query: 258 RLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 79 R +E E + R +E + +E + ++ ER+ S D+E + S + + Sbjct: 233 RSDLEDESKGRESRDRHYEKRRSELDDGHKRRERHDTHYERRRSEMDDESKRRESRDNHY 292 Query: 78 NDGDASADYQTKSKK 34 + D ++K ++ Sbjct: 293 ERRRSDLDDESKRRE 307 >At2g43160.3 68415.m05361 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/68 (20%), Positives = 35/68 (51%) Frame = -2 Query: 210 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 31 ++ +++ E S+Y + +R S +D + ++S ++ DG+ DY+ +S+ V Sbjct: 180 DYGSRDEERSSYGREREYGYRDDDRNS--RDGDRHSRDSEDRYGRDGNRDDDYRGRSRSV 237 Query: 30 EKNSARDK 7 + +R + Sbjct: 238 DNYGSRGR 245 >At2g43160.2 68415.m05360 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/68 (20%), Positives = 35/68 (51%) Frame = -2 Query: 210 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 31 ++ +++ E S+Y + +R S +D + ++S ++ DG+ DY+ +S+ V Sbjct: 180 DYGSRDEERSSYGREREYGYRDDDRNS--RDGDRHSRDSEDRYGRDGNRDDDYRGRSRSV 237 Query: 30 EKNSARDK 7 + +R + Sbjct: 238 DNYGSRGR 245 >At2g43160.1 68415.m05359 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/68 (20%), Positives = 35/68 (51%) Frame = -2 Query: 210 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 31 ++ +++ E S+Y + +R S +D + ++S ++ DG+ DY+ +S+ V Sbjct: 180 DYGSRDEERSSYGREREYGYRDDDRNS--RDGDRHSRDSEDRYGRDGNRDDDYRGRSRSV 237 Query: 30 EKNSARDK 7 + +R + Sbjct: 238 DNYGSRGR 245 >At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 domain-containing protein similar to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 900 Score = 27.9 bits (59), Expect = 4.0 Identities = 20/84 (23%), Positives = 35/84 (41%), Gaps = 5/84 (5%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSE----RKSSGKDEEYSEQNSSNKSFN 76 +++ E+N S + K E + D R VN G R + DEE + + + Sbjct: 91 KDRKEANSGSEDDRGKRIEVDSDGDGERRVNKGRNTDRVRADTSSDEEDDLKGNKKEPME 150 Query: 75 -DGDASADYQTKSKKVEKNSARDK 7 D D + +S KV + R++ Sbjct: 151 VDDDYGRRGRRRSPKVMEKQGRER 174 >At1g56110.1 68414.m06443 nucleolar protein Nop56, putative similar to XNop56 protein [Xenopus laevis] GI:14799394; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 522 Score = 27.9 bits (59), Expect = 4.0 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 8/87 (9%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK-SSGKDEEYSEQNSSN 88 E + V+ +S KK + E +E + DK+ +RK + ++ E SE+ + Sbjct: 436 EGKEPVDASVKKSKKKKAKGEEEEEVVAMEEDKSEKKKKKEKRKMETAEENEKSEKKKTK 495 Query: 87 KS-------FNDGDASADYQTKSKKVE 28 KS +DG ++ + KSK E Sbjct: 496 KSKAGGEEETDDGHSTKKKKKKSKSAE 522 >At1g19990.1 68414.m02504 expressed protein ; expression supported by MPSS Length = 251 Score = 27.9 bits (59), Expect = 4.0 Identities = 20/81 (24%), Positives = 34/81 (41%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 E K+ K+ E +NK S + N+GS++ K EE + + NK Sbjct: 5 EDVKAMKMKEEAEEDNKSLSSFAKKKPTNGNNAGSKKL---KKEENDDDDDDNKPIKSSV 61 Query: 66 ASADYQTKSKKVEKNSARDKK 4 + + + KK E + +KK Sbjct: 62 SGSRAKPVKKKEEIDKDDEKK 82 >At5g49430.1 68418.m06116 transducin family protein / WD-40 repeat family protein similar to WD-repeat protein 9 (SP:Q9NSI6) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies) Length = 1677 Score = 27.5 bits (58), Expect = 5.3 Identities = 16/65 (24%), Positives = 29/65 (44%) Frame = -2 Query: 195 EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSA 16 E E D+N S + E SSGK++E ++S +S + S + + ++ Sbjct: 777 EPEVDILSDENDSEYNVPEEYSSGKEQECLNSSTSGESGSSSGESYEDDDHQNSLRRSKR 836 Query: 15 RDKKK 1 + KK Sbjct: 837 KKHKK 841 >At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 613 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/56 (23%), Positives = 25/56 (44%) Frame = -2 Query: 270 WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 103 WL+E E+E+ + K E ++ Y+ + +G E + +DE + E Sbjct: 557 WLDENQNSEKEEYDEKLKEVEAVCNPIITAVYQRSGGAPGAGGESSTEEEDESHDE 612 >At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2) similar to SWISS-PROT: Q39043; GI:1303695; luminal binding protein (BiP) [Arabidopsis thaliana] Length = 668 Score = 27.5 bits (58), Expect = 5.3 Identities = 13/56 (23%), Positives = 25/56 (44%) Frame = -2 Query: 270 WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 103 WL+E E+E+ + K E ++ Y+ + +G E + +DE + E Sbjct: 612 WLDENQNSEKEEYDEKLKEVEAVCNPIITAVYQRSGGAPGAGGESSTEEEDESHDE 667 >At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28) identical to cDNA DEAD box RNA helicase, RH28 GI:3776026 Length = 789 Score = 27.5 bits (58), Expect = 5.3 Identities = 14/82 (17%), Positives = 37/82 (45%) Frame = -2 Query: 294 RNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 115 R+ D Q+ W + + + + + + K +++ +R S+N E + +D Sbjct: 65 RDADAQSPWDFASYSSSVGEEHARRHTTSIDEKISKAIQHRPVPISINEEEEEEEEEEDA 124 Query: 114 EYSEQNSSNKSFNDGDASADYQ 49 +E + + ++ D +A+Y+ Sbjct: 125 SDAETDKQEEYLSEDDEAAEYK 146 >At4g02110.1 68417.m00282 BRCT domain-containing protein contains Pfam domain, PF00533: BRCA1 C Terminus (BRCT) domain Length = 1293 Score = 27.5 bits (58), Expect = 5.3 Identities = 24/93 (25%), Positives = 37/93 (39%), Gaps = 10/93 (10%) Frame = -2 Query: 249 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSER----------KSSGKDEEYSEQ 100 VER +S KK + +SS + K SG+E S+ + E + Sbjct: 947 VERSSLQSGKKGSSSRVEVGKSSVKKTKKSEKGSGTEATDTVMKDVGDNSAKEKENIAVD 1006 Query: 99 NSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 N S K + GD S + K K K + +K+ Sbjct: 1007 NESRKVGSGGDQSPVARKKVAKSAKTGTKAEKE 1039 >At1g26680.1 68414.m03250 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 920 Score = 27.5 bits (58), Expect = 5.3 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -2 Query: 156 VNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD-YQTKSKKVEKNSARDKKK 1 VNS S SSG D SE+ S ++ D + S D +TK +K +S+ + + Sbjct: 841 VNSLSSNPSSGDDSSRSEE-SEEENMEDKNISQDCLETKKRKYCSSSSYSQNR 892 >At5g59730.1 68418.m07487 exocyst subunit EXO70 family protein leucine zipper-containing protein, Lycopersicon esculentum, PIR:S21495 contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 634 Score = 27.1 bits (57), Expect = 7.0 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = -2 Query: 249 VEREKSESNKKSREFENKEAES-STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 73 +E E K +RE+ + E S +YR S ++ + S + Y E F+ Sbjct: 102 LESEFHRVLKANREYLDPECVSVRSYRSSRFSTSTTTSVSDSEDESSYEENADEEHRFSG 161 Query: 72 GDASA 58 GD+ A Sbjct: 162 GDSDA 166 >At5g59610.1 68418.m07469 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9UXR9 Chaperone protein dnaJ (Heat shock protein 40 Methanosarcina thermophila, SP|Q9QYI6 DnaJ homolog subfamily B member 9 Mus musculus; contains Pfam profile PF00226 DnaJ domain Length = 268 Score = 27.1 bits (57), Expect = 7.0 Identities = 18/68 (26%), Positives = 32/68 (47%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EE + E E +K +++ E S+ + GS KSSGK+ S +NS Sbjct: 191 EELSEIGEEFVEFLEKELNISDEDNEGSSKNGERFDFEEGSTEKSSGKNNS-STKNSIED 249 Query: 84 SFNDGDAS 61 + ++ +A+ Sbjct: 250 NIDEIEAT 257 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 27.1 bits (57), Expect = 7.0 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESS-TYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 64 EK +S +++ K + +YR+ SG +S G+DE+ E + G A Sbjct: 1322 EKYQSEEEAALGRGKRLRKAVSYREAYAPHTSGPVNESGGEDEKEPEPELKKEYTPAGRA 1381 Query: 63 SADYQTKSKKVEKN 22 + TK ++ +KN Sbjct: 1382 LKEKFTKLRERQKN 1395 >At5g37010.1 68418.m04438 expressed protein Length = 637 Score = 27.1 bits (57), Expect = 7.0 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -2 Query: 216 SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE--QNSSNKSFNDGD 67 SRE ++ ++ S R++ S N G R+ S SE NSS S N + Sbjct: 186 SRERDDSKSNRSGSRERGSSGNGGGSRRVSRSPGRRSEINPNSSGNSVNSSN 237 Score = 26.6 bits (56), Expect = 9.3 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = -2 Query: 204 ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEK 25 E++EAE +R + R S ER+ E + + SN+S + S+ S++V + Sbjct: 158 EDEEAERRIHRQRQRGGESPRERRRRTPSRE-RDDSKSNRSGSRERGSSGNGGGSRRVSR 216 Query: 24 NSAR 13 + R Sbjct: 217 SPGR 220 >At5g23420.1 68418.m02747 high mobility group (HMG1/2) family protein similar to high mobility group protein 2 HMG2 [Ipomoea nil] GI:1052956; contains Pfam profile PF00505: HMG (high mobility group) box Length = 241 Score = 27.1 bits (57), Expect = 7.0 Identities = 19/82 (23%), Positives = 39/82 (47%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 E+ KS + ++ + + +K AE +K+ N E + + + ++ K +D D Sbjct: 151 EKWKSLTEEEKKVYLDKAAELKAEYNKSLESNDADEEEEDEEKQSDDVDDAEEKQVDDDD 210 Query: 66 ASADYQTKSKKVEKNSARDKKK 1 + + K+VE N+ DKK+ Sbjct: 211 -----EVEEKEVE-NTDDDKKE 226 >At5g22470.1 68418.m02621 poly (ADP-ribose) polymerase family protein similar to poly(ADP)-ribose polymerase [Zea mays] GI:3928871; contains Pfam profiles PF00644: Poly(ADP-ribose) polymerase catalytic domain, PF00533: BRCA1 C Terminus (BRCT) domain, PF05406: WGR domain Length = 815 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -2 Query: 147 GSERKSSGKDEEYSEQNSSNKSFND-GDASADYQTKSKKVEKNSARDKKK 1 G +S ++ +N +S N GDA+++Y K VE+N + D+ K Sbjct: 29 GKLPESEQSQKKAKPENDDGRSVNGAGDAASEYNEFCKAVEENLSIDQIK 78 >At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong similarity to RNA helicase RH26 [Arabidopsis thaliana] GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH26 GI:3776024 Length = 850 Score = 27.1 bits (57), Expect = 7.0 Identities = 18/79 (22%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = -2 Query: 249 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 70 V+ + SES+ + R N ++ SS +++V+SGS + S + +S + Sbjct: 189 VQGKSSESSFRGRSDRNVDSGSSFRGRSDKNVDSGSSFRGRNDRNVDSGSSFRGRSDRNV 248 Query: 69 DASADYQTKS-KKVEKNSA 16 D+ + ++ +S + V+ S+ Sbjct: 249 DSGSSFRGRSDRNVDSGSS 267 >At4g37210.2 68417.m05267 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q02508 Protein HGV2 Halocynthia roretzi; contains Pfam profile PF00515 TPR Domain Length = 377 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 64 +++ E ++S E+ A S D R +S + S GKD+ ++ + +D D Sbjct: 148 KKEGEVQQESSNGESL-APSVVSGDPERQGSSSGQEGSGGKDQGEDGEDCQDDDLSDADG 206 Query: 63 SAD 55 AD Sbjct: 207 DAD 209 >At4g37210.1 68417.m05268 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q02508 Protein HGV2 Halocynthia roretzi; contains Pfam profile PF00515 TPR Domain Length = 492 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -2 Query: 243 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 64 +++ E ++S E+ A S D R +S + S GKD+ ++ + +D D Sbjct: 148 KKEGEVQQESSNGESL-APSVVSGDPERQGSSSGQEGSGGKDQGEDGEDCQDDDLSDADG 206 Query: 63 SAD 55 AD Sbjct: 207 DAD 209 >At4g34400.1 68417.m04886 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 389 Score = 27.1 bits (57), Expect = 7.0 Identities = 21/85 (24%), Positives = 38/85 (44%) Frame = -2 Query: 255 LTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 76 +++ E +++ KS E +N E RDK +S E S DEE S + Sbjct: 128 ISLSSEDTDTGAKS-EMKNTVPEG---RDKGKSKVEVVE--DSDDDEEEDSVYSESSEET 181 Query: 75 DGDASADYQTKSKKVEKNSARDKKK 1 + D ++++ + K+ + KKK Sbjct: 182 ETDTDSEFKVAKPTIPKSQKKGKKK 206 >At3g11590.1 68416.m01416 expressed protein Length = 622 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -2 Query: 225 NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 79 N+++ ++ N +Y ++ V +G+E S D E N NKS+ Sbjct: 461 NEEAGDYLNHHISFGSYNIEDGEVENGNEEGSGESDLHSIELNIDNKSY 509 >At3g10800.1 68416.m01300 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; contains similarity to TGACG-sequence specific DNA-binding protein TGA-1B (HSBF) GB:P14233 [Nicotiana tabacum] Length = 675 Score = 27.1 bits (57), Expect = 7.0 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = -2 Query: 168 KNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 +NRS + G E +S + S Q S K+F A +S +K+S +KK Sbjct: 104 ENRSGDGGLEGRSESVHSQVSSQGS--KTFVSDTVDASSSPESSNHQKSSVSKRKK 157 >At2g40650.1 68415.m05016 pre-mRNA splicing factor PRP38 family protein contains Pfam profile PF03371: PRP38 family Length = 355 Score = 27.1 bits (57), Expect = 7.0 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = -2 Query: 318 RDRNQ*IIRNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 139 RDR+ R+ DR+ ER +R + S +SR+ + E + R++ + E Sbjct: 265 RDRDHYRERDRDRERGRDRERDRRDRARRRSRSRSRDRKRHETDDVRDREEPKKKKEKKE 324 Query: 138 R-KSSGKDEEYSEQNSSNK 85 + K G D E N+ Sbjct: 325 KMKEDGTDHPNPEIAEMNR 343 >At2g35210.1 68415.m04319 human Rev interacting-like family protein / hRIP family protein similar to ARFGAP1 protein GI:7211442 from [Homo sapiens]; contains InterPro accession IPR001164: Human Rev interacting-like protein (hRIP) Length = 395 Score = 27.1 bits (57), Expect = 7.0 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -2 Query: 231 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 67 E+++ ++F N ++ SS N + ++ E KSS K S SS F DGD Sbjct: 294 ETDEARKKFTNAKSISSAQYFGNDNNSADLEAKSSLKKFSGSSAISSADLFGDGD 348 >At1g66050.1 68414.m07497 zinc finger (C3HC4-type RING finger) family protein contains zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 623 Score = 27.1 bits (57), Expect = 7.0 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 120 DEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNS 19 +EE SSN S +G+ ++ TK K++KNS Sbjct: 582 EEEAEVAESSNISEEEGEEESEPPTKKIKMDKNS 615 >At1g63420.1 68414.m07172 expressed protein Length = 578 Score = 27.1 bits (57), Expect = 7.0 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -2 Query: 228 SNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 91 S KKS E + S++ ++NRS S S SG ++ +E N S Sbjct: 125 SEKKSPEETGSSVDCSSFLNQNRS-GSCSRTLQSGYNQNQTESNRS 169 >At1g22882.1 68414.m02857 expressed protein Length = 660 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 82 +KSE N + + + + + +++ +G+ + D E+ EQN NK+ Sbjct: 154 KKSEINNTGTWNDTEGKDDNNFLKQSQLNKTGTGNDTESSDNEFLEQNQMNKT 206 >At1g17665.1 68414.m02187 expressed protein Length = 338 Score = 27.1 bits (57), Expect = 7.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 93 SNKSFNDGDASADYQTKSKKVEKNSARDKK 4 S+K +D D D+ K KK +KN + KK Sbjct: 99 SDKKEDDSDWEGDHVKKKKKKKKNRGKKKK 128 >At5g57370.1 68418.m07168 expressed protein low similarity to nucleic acid binding protein [Homo sapiens] GI:431953 Length = 219 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/88 (21%), Positives = 37/88 (42%), Gaps = 6/88 (6%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESST--YRDKNRSVNS----GSERKSSGKDEEYSEQNSSNK 85 +RE+ + R NK++ S T + + R V S S +S +D + Q + Sbjct: 35 DRERDRERDRDRGLRNKKSRSRTPDHHARARHVRSPERYRSRSRSIDRDRDRDRQRHHRR 94 Query: 84 SFNDGDASADYQTKSKKVEKNSARDKKK 1 DA + + + V+ R++K+ Sbjct: 95 RSPSPDAPSRKRPRQGSVDDEKERNRKR 122 >At5g47680.1 68418.m05886 expressed protein contains Pfam profile PF04243: Protein of unknown function (DUF425) Length = 344 Score = 26.6 bits (56), Expect = 9.3 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = -2 Query: 240 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDAS 61 E ++ KK++E E+K E R + E ++ +EE + S KS Sbjct: 44 EAKKAEKKAQEKEHKRKEGE------RKLKEWEETLANATEEERLKLIESRKSLRKERME 97 Query: 60 ADYQTKSKKVEK-NSARD 10 + K KK+E+ N A++ Sbjct: 98 KRSEEKEKKIERLNQAKE 115 >At5g26210.1 68418.m03119 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 255 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -2 Query: 135 KSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARDKKK 1 K GKD+ NSSN+S + ++ + K K E ++++ Sbjct: 142 KKQGKDKSSVSNNSSNRSKSSSKRGSESRAKFSKPEPKDDEEEEE 186 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/88 (21%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = -2 Query: 315 DRNQ*-IIRNEDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 139 +RNQ II ++++ E R +++S R+ +E + RD++R + + Sbjct: 848 NRNQKSIIERKEKREDSQESSKKRHRGENKSQSPPRKSSTRERDHDLGRDRDRERHRDRD 907 Query: 138 RKSSGKDEEYSEQNSSNKSFNDGDASAD 55 R+ + + SS+ +D D S + Sbjct: 908 RQHDLNRDRDRREKSSSHDRDDNDRSKE 935 >At5g17580.1 68418.m02062 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 548 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/81 (23%), Positives = 33/81 (40%), Gaps = 3/81 (3%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESS---TYRDKNRSVNSGSERKSSGKDEEYSEQNS 94 EE + V ++ E K S + E E+ +R KN ++ NS Sbjct: 463 EEEIEVSSDEDEMEKMSNKLLGLEIENDECVVHRRKNMKKKKKKISVWGQVKRKFGCLNS 522 Query: 93 SNKSFNDGDASADYQTKSKKV 31 S+ S++ + D + K KK+ Sbjct: 523 SSSSYSVDACTCDVKKKKKKI 543 >At4g40020.1 68417.m05666 hypothetical protein Length = 615 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/63 (22%), Positives = 31/63 (49%) Frame = -2 Query: 264 EERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 85 EE+ ++EK ES K+ +E K+ + ++K + +++ GK +S ++ Sbjct: 405 EEKKENKKEKKESKKEKKEHSEKKED----KEKKEQTHQNFDKRMIGKTCSFSIMKLAHH 460 Query: 84 SFN 76 + N Sbjct: 461 NHN 463 >At4g14310.2 68417.m02205 peroxisomal membrane protein-related contains weak similarity to Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein) (Swiss-Prot:P42925) [Mus musculus] Length = 965 Score = 26.6 bits (56), Expect = 9.3 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 1/83 (1%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN-DG 70 E+ K+ K S + NKE R + S ++ K+S + + SNK+ N + Sbjct: 358 EKNKTTKAKSSVKGLNKEELEDRLLPHQRLLRSRTQSKTSSHVSKGHDSVESNKAVNAEE 417 Query: 69 DASADYQTKSKKVEKNSARDKKK 1 SA + + +E ++ DK+K Sbjct: 418 KPSAPVEENAIALEFLASLDKEK 440 >At4g14310.1 68417.m02204 peroxisomal membrane protein-related contains weak similarity to Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein) (Swiss-Prot:P42925) [Mus musculus] Length = 1087 Score = 26.6 bits (56), Expect = 9.3 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 1/83 (1%) Frame = -2 Query: 246 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN-DG 70 E+ K+ K S + NKE R + S ++ K+S + + SNK+ N + Sbjct: 358 EKNKTTKAKSSVKGLNKEELEDRLLPHQRLLRSRTQSKTSSHVSKGHDSVESNKAVNAEE 417 Query: 69 DASADYQTKSKKVEKNSARDKKK 1 SA + + +E ++ DK+K Sbjct: 418 KPSAPVEENAIALEFLASLDKEK 440 >At4g04400.1 68417.m00634 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 735 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = -2 Query: 144 SERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARD 10 S KSS + SEQ +S NDGDA+ TK + + +ARD Sbjct: 15 STEKSSSGEVSTSEQVTSEIE-NDGDAADLVPTKPAGLTEPAARD 58 >At3g26910.1 68416.m03367 hydroxyproline-rich glycoprotein family protein common family member:At2g33490 [Arabidopsis thaliana] Length = 608 Score = 26.6 bits (56), Expect = 9.3 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -2 Query: 126 GKDEEYSEQNSSNKSF--NDGDASADYQTKSKKVEKNS 19 G + E SE + + + +G+ S DY+T +KVE +S Sbjct: 244 GNEMEASEDDDDDGRYMNREGELSFDYRTNEQKVEASS 281 >At2g38370.1 68415.m04714 expressed protein Length = 522 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -2 Query: 168 KNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA--DYQTKSKKVEKNSA 16 KN S + ++S GK+ E + KSF S + ++K+KK +K A Sbjct: 466 KNSSSDKTVSKRSEGKENEKRTKTRKRKSFGFAKISVLLNKESKNKKKKKKIA 518 >At2g31970.1 68415.m03906 DNA repair-recombination protein (RAD50) identical to DNA repair-recombination protein GI:7110148 from [Arabidopsis thaliana] Length = 1316 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = -2 Query: 315 DRNQ*IIRNEDRQA*WLEERLTVEREKSESNKKSREFENKEAE 187 +RN+ ++RN+D+ +E+ L K++ + +RE E+ E + Sbjct: 1016 NRNKDLMRNQDQLRRNIEDNLNYRTTKAKVEELTREIESLEEQ 1058 >At2g04870.1 68415.m00503 hypothetical protein Length = 72 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -2 Query: 159 SVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARD 10 S N G E +SSG D+ + N+GD DY ++ ++ RD Sbjct: 27 SENVGGENRSSGDDDSVVK--------NEGDDKGDYDDSDERDDRGGDRD 68 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 26.6 bits (56), Expect = 9.3 Identities = 21/72 (29%), Positives = 32/72 (44%) Frame = -2 Query: 288 EDRQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 109 +DR A + + + +S +K E E E S R + E+K D E Sbjct: 83 DDRLAELAQSQAQKHQLHLQSIEKDGEVERMSTEMSELHKSKRQLMELLEQK----DAEI 138 Query: 108 SEQNSSNKSFND 73 SE+NS+ KS+ D Sbjct: 139 SEKNSTIKSYLD 150 >At1g61690.1 68414.m06958 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 1155 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = -2 Query: 282 RQA*WLEERLTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE 103 ++A LE RL E E K R+ E R+K S +S + + SG+D + Sbjct: 946 QEAKLLERRLQ-EGENPSPEKLGRDDMVSTTEDPPAREKENSPSSSAPKAMSGRDRFKLQ 1004 Query: 102 QNS 94 Q S Sbjct: 1005 QES 1007 >At1g24120.1 68414.m03043 DNAJ heat shock protein, putative similar to Altered Response to Gravity [Arabidopsis thaliana] GI:4249662; contains Pfam profile PF00226 DnaJ domain Length = 436 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 3/74 (4%) Frame = -2 Query: 213 REFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS---NKSFNDGDASADYQTK 43 R S+++ + +E++ ++EE E+ SS NK + D S + K Sbjct: 361 RSSSKNRMRKSSFKKAAAKAPAPTEQEEEEEEEEEEEEESSRQKNKKPSTCDKSETLKKK 420 Query: 42 SKKVEKNSARDKKK 1 SK + DKKK Sbjct: 421 SKWFNLHLKLDKKK 434 >At1g05440.1 68414.m00552 expressed protein ; expression supported by MPSS Length = 393 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -2 Query: 258 RLTVEREKSESNKKSREFENKEAESSTYRDK 166 +L + K + KKS+ FEN+E +T +++ Sbjct: 128 KLMISSPKKKLTKKSKVFENEEQRKTTKKER 158 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,237,466 Number of Sequences: 28952 Number of extensions: 112080 Number of successful extensions: 1145 Number of sequences better than 10.0: 166 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1113 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -