BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0480.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.07 |ndk1||nucleoside diphosphate kinase|Schizosaccharomy... 98 7e-22 SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|ch... 26 3.6 SPAC4F10.04 |||protein phosphatase type 2A, intrinsic regulator ... 25 4.8 >SPAC806.07 |ndk1||nucleoside diphosphate kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 97.9 bits (233), Expect = 7e-22 Identities = 44/85 (51%), Positives = 59/85 (69%) Frame = -2 Query: 495 QRGLVGTIIXRFEKKGFXLVGLKFVWPSEXLLQQHYIDLASRPFFPGLVKYMSSXPXVXM 316 QRGL+G II +FE KG+ L LKF+ PS L+++HY + +PF+ LV +M+S P M Sbjct: 16 QRGLIGYIISKFELKGYKLRALKFLVPSRDLVEEHYAEHKGKPFYEKLVGFMASGPVCAM 75 Query: 315 VWEGLNXVKTGRQMLGASNPVTCSP 241 +WEG VKTGR MLGASNP+ +P Sbjct: 76 IWEGKQAVKTGRLMLGASNPLDSAP 100 Score = 63.3 bits (147), Expect = 2e-11 Identities = 28/57 (49%), Positives = 35/57 (61%) Frame = -1 Query: 259 PSDLQPGTIXGDLCIXVGRXIIHGSDSVESAKKEIGLWXXDKEVVGWTPANEXWVYE 89 P D PGTI GD I +GR + HGSDS+ESA +EI LW E+ + E W+YE Sbjct: 95 PLDSAPGTIRGDYGIDLGRNVCHGSDSIESANREIKLWFQPSEIQVYDRTIEPWIYE 151 >SPCC757.04 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 684 Score = 25.8 bits (54), Expect = 3.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 159 SFLADSTLSEPWMMXRPTXMQRSPXIVPGCKSL 257 S++AD + ++M RPT ++RS +PG L Sbjct: 352 SYVADKFIG--FIMGRPTMLKRSDASIPGSNQL 382 >SPAC4F10.04 |||protein phosphatase type 2A, intrinsic regulator |Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 25.4 bits (53), Expect = 4.8 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 460 RKERXXTSRFEIRMAIRXASPAT-LHRFGIPAFLPWSSKVHE 338 R E+ ++ + PA+ HRFG PAF W K+ + Sbjct: 72 RVEKLVRILCRVKEITKTVPPASGRHRFGNPAFRIWHEKLRD 113 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,778,214 Number of Sequences: 5004 Number of extensions: 30504 Number of successful extensions: 56 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -