BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0479.Seq (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|ch... 29 0.76 SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosacchar... 26 4.1 SPCC576.11 |rpl15||60S ribosomal protein L15|Schizosaccharomyces... 25 9.4 SPAC1783.08c |rpl1502|rpl15-2|60S ribosomal protein L15b|Schizos... 25 9.4 >SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 497 Score = 28.7 bits (61), Expect = 0.76 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 172 IFAFPYPERLTVHKTXIMGLNNVLHYENNTFNW 270 I AF Y ++ T + + IMG+ L+ N +NW Sbjct: 59 ISAFQYMDKSTSNYSSIMGIRTDLNMVGNQYNW 91 >SPBC19F5.03 |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 26.2 bits (55), Expect = 4.1 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -1 Query: 444 NPVYFCCXTFVLTRQGRSCDFGAKTNSLSSADTSHGLLTCDIW 316 N V C +VLT Q R C T+ L S + C+IW Sbjct: 387 NVVQSCIGRWVLTNQLRKCGIIGATHPLRSVIPLDNIF-CNIW 428 >SPCC576.11 |rpl15||60S ribosomal protein L15|Schizosaccharomyces pombe|chr 3|||Manual Length = 201 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 331 YLRHLAEGRGANVSCFISAMAN*MYCSRNVVHYLNP*SR 215 YL LA+ + ++V+ F+S + Y NV+H + SR Sbjct: 6 YLEELAKKKQSDVNLFLSRVRAWEYRQMNVIHRASRPSR 44 >SPAC1783.08c |rpl1502|rpl15-2|60S ribosomal protein L15b|Schizosaccharomyces pombe|chr 1|||Manual Length = 201 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 331 YLRHLAEGRGANVSCFISAMAN*MYCSRNVVHYLNP*SR 215 YL LA+ + ++V+ F+S + Y NV+H + SR Sbjct: 6 YLEELAKKKQSDVNLFLSRVRAWEYRQMNVIHRASRPSR 44 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,657,532 Number of Sequences: 5004 Number of extensions: 53008 Number of successful extensions: 109 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -