BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0479.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0076 - 18861629-18861862,18862421-18862532,18863001-18863146 28 5.6 12_01_0997 - 10114571-10114864,10115422-10115795,10115910-10116144 28 7.4 >11_05_0076 - 18861629-18861862,18862421-18862532,18863001-18863146 Length = 163 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 71 GLDCLIN*ITRPHSKDHIRPRYNNHTEVRNYHLQFLRSHTPNVLP 205 GLD N S D RP + + ++ N+ LQ + TP LP Sbjct: 111 GLDAATNCARAVPSFDRDRPNFLSTSKKHNHELQLINWSTPPALP 155 >12_01_0997 - 10114571-10114864,10115422-10115795,10115910-10116144 Length = 300 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/24 (54%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -1 Query: 351 DTS-HGLLTCDIWLKGGGPMYHVL 283 DTS +G+L C KGG PMYH++ Sbjct: 220 DTSANGMLVCTTIDKGGLPMYHLV 243 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,138,573 Number of Sequences: 37544 Number of extensions: 308514 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -