BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0479.Seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 25 1.6 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 25 2.1 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 25 2.1 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 25 2.1 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 25 2.1 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 25 2.1 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 25 2.1 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 25 2.1 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 25 2.1 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 25 2.1 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 25 2.1 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 25 2.1 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 25 2.1 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 25 2.1 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 25 2.1 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 25 2.1 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 25 2.1 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 25 2.1 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 25 2.1 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 25 2.1 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 2.7 Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 23 6.3 AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal ... 23 8.3 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 23 8.3 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +2 Query: 2 TXILYFIHIFDNMVGELWTKE*KGLDCLIN*ITRPH 109 T +YF+ F + W K+ +G+ C + T H Sbjct: 354 TGDVYFVPAFTGLYAPYWRKDARGIFCGLTSFTTKH 389 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 21 DHNRPEYNNYGRFKDTFEHFYGAHNFN 47 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 21 DHNRPEYNNYGRFKDTFEHFYGAHNFN 47 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 23 DHNRPEYNNYGRFKDTFEHFYGAHNFN 49 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 23 DHNRPEYNNYGRFKDTFEHFYGAHNFN 49 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 26 DHNRPEYNNYGRFKDTFEHFYGAHNFN 52 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 26 DHNRPEYNNYGRFKDTFEHFYGAHNFN 52 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 36 DHNRPEYNNYGRFKDTFEHFYGAHNFN 62 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 38 DHNRPEYNNYGRFKDTFEHFYGAHNFN 64 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 38 DHNRPEYNNYGRFKDTFEHFYGAHNFN 64 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 20 DHNRPEYNNYGRFKDTFEHFYGAHNFN 46 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 20 DHNRPEYNNYGRFKDTFEHFYGAHNFN 46 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 25.0 bits (52), Expect = 2.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 116 DHIRPRYNNHTEVRNYHLQFLRSHTPN 196 DH RP YNN+ ++ F +H N Sbjct: 35 DHNRPEYNNYGRFKDTFEHFYGAHNFN 61 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 369 LFWRQNHTIVLALSKRKXNNRNK 437 + W N TIV+ L+K K R K Sbjct: 1050 MLWEHNSTIVVMLTKLKEMGREK 1072 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 23.4 bits (48), Expect = 6.3 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 296 CIMFYFSHGQLNVLFS*CSTLFKPII 219 C M+Y+ GQ++V + C+ F I+ Sbjct: 197 CSMWYWKDGQMDVYYFVCNYSFTNIM 222 >AY187042-1|AAO39756.1| 248|Anopheles gambiae putative antennal carrier protein TOL-2 protein. Length = 248 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 302 PPPFSQMSQVSKPCEVSALDNEF 370 P +SQ +PC V A+ N F Sbjct: 23 PASYSQCKTGDEPCVVQAITNTF 45 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 128 PRYNN-HTEVRNYHLQFLRSHTPNV 199 P Y+N H E+R Q++ +H P++ Sbjct: 190 PDYSNFHKEIREATKQYVATHCPHL 214 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 677,772 Number of Sequences: 2352 Number of extensions: 13385 Number of successful extensions: 69 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -