BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0472.Seq (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0275 - 20300994-20301150,20301582-20301670,20302779-203029... 33 0.17 >01_05_0275 - 20300994-20301150,20301582-20301670,20302779-20302937, 20303015-20303255,20303453-20303569,20304804-20304866, 20305009-20305118,20306418-20306495 Length = 337 Score = 32.7 bits (71), Expect = 0.17 Identities = 22/95 (23%), Positives = 48/95 (50%), Gaps = 4/95 (4%) Frame = -3 Query: 320 TLC*I*TR--FVRATSTYII*XNKKIVYCIFLDFITXXIKLGSVXSXACRRGCRTXAGSC 147 T C I T+ F + TSTY++ + I+ + L + ++ + + + + + Sbjct: 23 TRCTILTKVAFSQGTSTYVLVFYRNIIAAVVLLPVALAVERKTAPPLSLKVSLKLFVHAL 82 Query: 146 CGRTAA-SCRCCGCSWAAFLAVAAI-SISPICSTF 48 CG +AA + C G ++++ A +A+ +I P+ + F Sbjct: 83 CGMSAAMNISCIGLNYSSATAASAVQNIMPVLTFF 117 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,240,731 Number of Sequences: 37544 Number of extensions: 123060 Number of successful extensions: 258 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 258 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -