BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0471.Seq (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.0 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 23 2.0 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 4.5 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.9 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -2 Query: 168 VLPVLEDKYLVLRLLWPSRLYRVWKSSILKPQKL 67 +LP+ ++ YL++ + L W ++LK KL Sbjct: 70 MLPIYKNTYLIILFADFAYLETTWICTLLKKDKL 103 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -2 Query: 168 VLPVLEDKYLVLRLLWPSRLYRVWKSSILKPQKL 67 +LP+ ++ YL++ + L W ++LK KL Sbjct: 88 MLPIYKNTYLIILFADFAYLETTWICTLLKKDKL 121 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.8 bits (44), Expect = 4.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 11 HR*EPGCIREILG 49 H EP CI E+LG Sbjct: 352 HTPEPDCIHELLG 364 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 114 RLYRVWKSSILKPQKLGPT 58 +L+R+ KSS L+P G T Sbjct: 896 KLFRMKKSSALRPASGGTT 914 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 84 LKPQKLGPTKAMPSISLIHPGS 19 L+PQ+L PT + HP + Sbjct: 76 LQPQRLAPTHLQSPNTQTHPSA 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,124 Number of Sequences: 336 Number of extensions: 1769 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -