BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0470.Seq (459 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces po... 27 1.4 SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-pho... 24 9.7 SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|... 24 9.7 >SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 27.1 bits (57), Expect = 1.4 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -1 Query: 177 ITQIIILRV*FLLHDVIPSLWKSIVNI 97 +T I+L + F+LHD S+W+S+V I Sbjct: 220 LTGTILLVIMFVLHDGSLSIWQSLVMI 246 >SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-phosphate 5-kinase Fab1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1932 Score = 24.2 bits (50), Expect = 9.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 38 TGVRIPQAGTNFSNEIRTQEMF 103 T IP+A +F+N+I TQ F Sbjct: 1302 TSSDIPKANIDFTNDISTQNTF 1323 >SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 24.2 bits (50), Expect = 9.7 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = -1 Query: 279 LPHPSNRNDYCFTAEIGGVVVPTRADSQEVLP----PVITQIIILR 154 +PH + + C++ GG A S+ VLP P IT I+R Sbjct: 400 IPHQIHFSGTCYSVAAGGWQSAALAISESVLPEVNVPPITTFSIIR 445 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,982,789 Number of Sequences: 5004 Number of extensions: 39431 Number of successful extensions: 78 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -