BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0470.Seq (459 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 33 0.11 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 33 0.11 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 33 0.11 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 33 0.11 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 33 0.11 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 33 0.11 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 33 0.11 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 33 0.11 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 33 0.11 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 33 0.15 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.15 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 33 0.15 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.15 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.15 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.15 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 33 0.15 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 33 0.15 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.15 SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_21395| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_279| Best HMM Match : rve (HMM E-Value=3.2) 31 0.61 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.80 SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) 30 0.80 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.80 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.80 SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.80 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.80 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_51888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_51705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_50119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_43838| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_37253| Best HMM Match : Atrophin-1 (HMM E-Value=0.68) 29 1.4 SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_34139| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 29 1.4 SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) 29 1.4 SB_24999| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) 29 1.4 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 29 1.4 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_57935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_54293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_50619| Best HMM Match : RnaseH (HMM E-Value=0.89) 29 1.4 SB_50082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_48851| Best HMM Match : zf-C2H2 (HMM E-Value=3.2e-13) 29 1.4 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_44853| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 29 1.4 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_26387| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) 29 1.4 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 29 1.4 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_7465| Best HMM Match : RHH_1 (HMM E-Value=6.7) 29 1.4 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_2527| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_45222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_16927| Best HMM Match : bZIP_1 (HMM E-Value=9.8) 29 1.8 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_44598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) 29 1.8 SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) 29 1.8 SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_15196| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 29 2.4 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 29 2.4 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 29 2.4 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) 28 3.2 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 28 3.2 SB_51382| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 28 3.2 SB_29458| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_28685| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 28 3.2 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 28 3.2 SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) 28 4.3 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 28 4.3 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 28 4.3 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 28 4.3 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_4964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_56357| Best HMM Match : Ank (HMM E-Value=1.2e-06) 28 4.3 SB_53858| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_53755| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_50474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_28611| Best HMM Match : MAM (HMM E-Value=4.4e-22) 28 4.3 SB_26020| Best HMM Match : UCR_TM (HMM E-Value=6.4) 28 4.3 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_17552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 28 4.3 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 28 4.3 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 28 4.3 SB_59325| Best HMM Match : zf-CCHC (HMM E-Value=7.2) 27 5.6 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 27 5.6 SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) 27 5.6 SB_49689| Best HMM Match : fn3 (HMM E-Value=5.9) 27 5.6 SB_49234| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_48128| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 27 5.6 SB_45357| Best HMM Match : Sigma_1s (HMM E-Value=5.6) 27 5.6 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 27 5.6 SB_33473| Best HMM Match : GST_N (HMM E-Value=0.028) 27 5.6 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 27 5.6 SB_21775| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 27 5.6 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_12448| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_9745| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_8585| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_5820| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) 27 5.6 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 27 5.6 SB_56836| Best HMM Match : GAF (HMM E-Value=2.8e-07) 27 5.6 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) 27 5.6 SB_52067| Best HMM Match : Pkinase_C (HMM E-Value=6.9) 27 5.6 SB_46902| Best HMM Match : GYR (HMM E-Value=1.1) 27 5.6 SB_40896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_40844| Best HMM Match : DUF595 (HMM E-Value=6.1) 27 5.6 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 27 5.6 SB_39500| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_38057| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_34485| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_12437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 27 5.6 SB_7597| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_2338| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.6 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 27 7.5 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 7.5 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 27 7.5 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 27 7.5 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 27 7.5 SB_38866| Best HMM Match : HHH (HMM E-Value=0.00018) 27 7.5 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_21862| Best HMM Match : ABC_membrane_2 (HMM E-Value=1) 27 7.5 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_18977| Best HMM Match : DUF834 (HMM E-Value=8.8) 27 7.5 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) 27 7.5 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 27 7.5 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 27 7.5 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) 27 7.5 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_48920| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 27 7.5 SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_34258| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 27 7.5 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_30561| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 27 7.5 SB_21460| Best HMM Match : GAS2 (HMM E-Value=0.0008) 27 7.5 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 27 7.5 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) 27 7.5 SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_56823| Best HMM Match : Rhabdo_NV (HMM E-Value=7.4) 27 9.9 SB_52226| Best HMM Match : Cytadhesin_P30 (HMM E-Value=9) 27 9.9 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 27 9.9 SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41670| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_38876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_34526| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 27 9.9 SB_27102| Best HMM Match : Lysine_decarbox (HMM E-Value=1.19993e... 27 9.9 SB_21609| Best HMM Match : Peptidase_M23 (HMM E-Value=5.7) 27 9.9 SB_19744| Best HMM Match : HSP9_HSP12 (HMM E-Value=2.1) 27 9.9 SB_18864| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_10157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_7416| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_5967| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_4893| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_3631| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_53616| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 27 9.9 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_38974| Best HMM Match : WD40 (HMM E-Value=1.1e-19) 27 9.9 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_36159| Best HMM Match : Peptidase_M28 (HMM E-Value=0) 27 9.9 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_35314| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_34069| Best HMM Match : ARID (HMM E-Value=4.8e-14) 27 9.9 SB_33849| Best HMM Match : TrbI (HMM E-Value=3.8e-33) 27 9.9 SB_32568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_24801| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 27 9.9 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_15230| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_11742| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) 27 9.9 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 27 9.9 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 9 PLEVDGIDKLDIEF 22 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 27 PLEVDGIDKLDIEF 40 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 52 PLEVDGIDKLDIEF 65 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 24 PLEVDGIDKLDIEF 37 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 9 PLEVDGIDKLDIEF 22 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 23 PLEVDGIDKLDIEF 36 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 24 PLEVDGIDKLDIEF 37 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 27 PLEVDGIDKLDIEF 40 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 11 PLEVDGIDKLDIEF 24 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.1 bits (72), Expect = 0.11 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 403 SKSGREFDIKLIDTVDLEG 459 S +EFDIKLIDTVDLEG Sbjct: 17 SPGQQEFDIKLIDTVDLEG 35 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 23 PLEVDGIDKLDIEF 36 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 60 PLEVDGIDKLDIEF 73 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLDIEF Sbjct: 22 PLEVDGIDKLDIEF 35 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 67 QEFDIKLIDTVDLEG 81 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 116 QEFDIKLIDTVDLEG 130 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +EFDIKLIDTVDLEG Sbjct: 21 QEFDIKLIDTVDLEG 35 >SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 31.9 bits (69), Expect = 0.26 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAH 379 PLEVDGIDKLDI +A +++ AH Sbjct: 9 PLEVDGIDKLDITTSAPVQVSITTLAH 35 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.26 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLE+DGIDKLDIEF Sbjct: 9 PLELDGIDKLDIEF 22 >SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 31.1 bits (67), Expect = 0.46 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAHLVLS 367 PLEVDGIDKLD++ + L + ++LS Sbjct: 22 PLEVDGIDKLDVDVVLKVSLTAIVVFEVMLS 52 >SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 31.1 bits (67), Expect = 0.46 Identities = 17/30 (56%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAAL--RLVDELTAHL 376 PLEVDGIDKLD + + L L ELT L Sbjct: 9 PLEVDGIDKLDKDLTSELTKELTSELTKDL 38 >SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 30.7 bits (66), Expect = 0.61 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELT 385 PLEVDGIDKLD+++ LR E T Sbjct: 22 PLEVDGIDKLDVQY-TGLRKKQENT 45 >SB_21395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 30.7 bits (66), Expect = 0.61 Identities = 20/36 (55%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 355 APVTT*H-QVGCELVHQSKSGREFDIKLIDTVDLEG 459 APV H +V V K G+E IKLIDTVDLEG Sbjct: 6 APVHPIHLRVSAAQVFLMKEGKE-GIKLIDTVDLEG 40 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 30.7 bits (66), Expect = 0.61 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 406 KSGREFDIKLIDTVDLEG 459 KS ++ DIKLIDTVDLEG Sbjct: 71 KSRQKTDIKLIDTVDLEG 88 >SB_279| Best HMM Match : rve (HMM E-Value=3.2) Length = 188 Score = 30.7 bits (66), Expect = 0.61 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAHLVLSG 364 PLEVDGIDKLD E A ++++ AH G Sbjct: 9 PLEVDGIDKLD-EDTLAPTVIEKTQAHFARYG 39 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.3 bits (65), Expect = 0.80 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 +++DIKLIDTVDLEG Sbjct: 34 KKYDIKLIDTVDLEG 48 >SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) Length = 166 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 Query: 403 SKSGREFDIKLIDTVDLEG 459 SK + DIKLIDTVDLEG Sbjct: 145 SKVAKHEDIKLIDTVDLEG 163 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 400 QSKSGREFDIKLIDTVDLEG 459 ++KS R IKLIDTVDLEG Sbjct: 16 RTKSSRTSTIKLIDTVDLEG 35 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 30.3 bits (65), Expect = 0.80 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELT 385 PLEVDGIDKLDI A +RL + T Sbjct: 22 PLEVDGIDKLDI---AVIRLFEGFT 43 >SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 30.3 bits (65), Expect = 0.80 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAH 379 PLEVDGIDKLD E + + + +AH Sbjct: 22 PLEVDGIDKLDAEKVLIIFIDQKPSAH 48 >SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 30.3 bits (65), Expect = 0.80 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAAL 406 PLEVDGIDKLD F A+ Sbjct: 22 PLEVDGIDKLDAVFLTAI 39 >SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 R+ DIKLIDTVDLEG Sbjct: 9 RKVDIKLIDTVDLEG 23 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +1 Query: 373 HQVGCELVHQSKSGREFDIKLIDTVDLEG 459 HQV + +H KSG IKLIDTVDLEG Sbjct: 107 HQVSEQGIHW-KSGTS--IKLIDTVDLEG 132 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 458 PSRSTVSISLISNS 417 PSRSTVSISLISNS Sbjct: 24 PSRSTVSISLISNS 37 >SB_51888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 87 YQAYRYRRPRG 97 >SB_51705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 66 YQAYRYRRPRG 76 >SB_50119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 26 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 6 YQAYRYRRPRG 16 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +1 Query: 388 ELVHQSKSGREFDIKLIDTVDLEG 459 E+ Q S E IKLIDTVDLEG Sbjct: 9 EVQRQIISEMEISIKLIDTVDLEG 32 >SB_43838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 37 YQAYRYRRPRG 47 >SB_37253| Best HMM Match : Atrophin-1 (HMM E-Value=0.68) Length = 1113 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 593 YQAYRYRRPRG 603 >SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 116 YQAYRYRRPRG 126 >SB_34139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 29 YQAYRYRRPRG 39 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 27 YQAYRYRRPRG 37 >SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) Length = 151 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAA-LRLVDELTAHLVLSG-YWSP 352 PLEVDGIDKLD+ A R +D ++ G +SP Sbjct: 22 PLEVDGIDKLDVVTAVRNFRYLDVFLRRVMTDGIVYSP 59 >SB_24999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 65 YQAYRYRRPRG 75 >SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) Length = 435 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 14 YQAYRYRRPRG 24 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 412 GREFDIKLIDTVDLEG 459 GR+ IKLIDTVDLEG Sbjct: 53 GRKVKIKLIDTVDLEG 68 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 533 YQAYRYRRPRG 543 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAHLVLS 367 PLEVDGIDKLD + A + D +L S Sbjct: 22 PLEVDGIDKLDPQRRVAFHIHDISAGYLQAS 52 >SB_57935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 27 YQAYRYRRPRG 37 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 458 PSRSTVSISLISNS 417 PSRSTVSISLISNS Sbjct: 24 PSRSTVSISLISNS 37 >SB_54293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 96 YQAYRYRRPRG 106 >SB_50619| Best HMM Match : RnaseH (HMM E-Value=0.89) Length = 724 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 432 YQAYRYRRPRG 442 >SB_50082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 21 YQAYRYRRPRG 31 >SB_48851| Best HMM Match : zf-C2H2 (HMM E-Value=3.2e-13) Length = 169 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAHL 376 PLEVDGIDKLD + + L HL Sbjct: 9 PLEVDGIDKLDDKCGIYFSQIGHLKQHL 36 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 458 PSRSTVSISLISNS 417 PSRSTVSISLISNS Sbjct: 24 PSRSTVSISLISNS 37 >SB_44853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 43 YQAYRYRRPRG 53 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 458 PSRSTVSISLISNS 417 PSRSTVSISLISNS Sbjct: 24 PSRSTVSISLISNS 37 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 458 PSRSTVSISLISNS 417 PSRSTVSISLISNS Sbjct: 24 PSRSTVSISLISNS 37 >SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) Length = 128 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 37 YQAYRYRRPRG 47 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.5 bits (63), Expect = 1.4 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAHLVLSGYWSP*TSTM*MRHPP 319 PLEVDGIDKLD++ +R ++++ + LS SP + R PP Sbjct: 22 PLEVDGIDKLDLDI-DVIRCLNKVQS---LSNSCSPGDPLVLERPPP 64 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 458 PSRSTVSISLISNS 417 PSRSTVSISLISNS Sbjct: 24 PSRSTVSISLISNS 37 >SB_26734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 94 YQAYRYRRPRG 104 >SB_26387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 24 YQAYRYRRPRG 34 >SB_26286| Best HMM Match : DUF963 (HMM E-Value=0.82) Length = 167 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 147 YQAYRYRRPRG 157 >SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) Length = 236 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 35 YQAYRYRRPRG 45 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 458 PSRSTVSISLISNS 417 PSRSTVSISLISNS Sbjct: 24 PSRSTVSISLISNS 37 >SB_7465| Best HMM Match : RHH_1 (HMM E-Value=6.7) Length = 71 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 58 YQAYRYRRPRG 68 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -2 Query: 458 PSRSTVSISLISNS 417 PSRSTVSISLISNS Sbjct: 22 PSRSTVSISLISNS 35 >SB_2527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 YQAYRYRRPRG Sbjct: 24 YQAYRYRRPRG 34 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 1.4 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIE 421 PLEVDGIDKLDI+ Sbjct: 22 PLEVDGIDKLDID 34 >SB_45222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 37 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 406 KSGREFDIKLIDTVDLEG 459 K +++ IKLIDTVDLEG Sbjct: 17 KKAKDYFIKLIDTVDLEG 34 >SB_16927| Best HMM Match : bZIP_1 (HMM E-Value=9.8) Length = 82 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +1 Query: 400 QSKSGREFDIKLIDTVDLEG 459 QSK +IKLIDTVDLEG Sbjct: 60 QSKLTTRSEIKLIDTVDLEG 79 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAH 379 PLEVDGIDKLD E AA V H Sbjct: 22 PLEVDGIDKLDPE--AAFEKVSHCALH 46 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIE 421 PLEVDGIDKLD++ Sbjct: 22 PLEVDGIDKLDVD 34 >SB_44598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/19 (84%), Positives = 16/19 (84%), Gaps = 1/19 (5%) Frame = +1 Query: 406 KSGREF-DIKLIDTVDLEG 459 KS R F DIKLIDTVDLEG Sbjct: 41 KSKRCFTDIKLIDTVDLEG 59 >SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) Length = 197 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/33 (51%), Positives = 22/33 (66%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAHLVLSGY 361 PLEVDGIDKLD+ AL +V A +++S Y Sbjct: 22 PLEVDGIDKLDVS-KYALVIVSNY-ALVIVSNY 52 >SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) Length = 137 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAA 409 PLEVDGIDKLD+ A Sbjct: 22 PLEVDGIDKLDVTLKTA 38 >SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIE 421 PLEVDGIDKLD++ Sbjct: 22 PLEVDGIDKLDVD 34 >SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 409 SGREFDIKLIDTVDLEG 459 + + F+IKLIDTVDLEG Sbjct: 2 NAQRFNIKLIDTVDLEG 18 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAA 409 PLEVDGIDKLD AA Sbjct: 22 PLEVDGIDKLDAGLMAA 38 >SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +1 Query: 406 KSGREFDIKLIDTVDLEG 459 K GRE IKLIDTVDLEG Sbjct: 111 KQGRE--IKLIDTVDLEG 126 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLDI Sbjct: 22 PLEVDGIDKLDI 33 >SB_15196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIE 421 PLEVDGIDKLD++ Sbjct: 22 PLEVDGIDKLDVK 34 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLDI Sbjct: 22 PLEVDGIDKLDI 33 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 412 GREFDIKLIDTVDLEG 459 GR+ IKLIDTVDLEG Sbjct: 21 GRDVLIKLIDTVDLEG 36 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 28.7 bits (61), Expect = 2.4 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -1 Query: 459 PLEVDGIDKLDIEFA--AALRLVDELTAHL-VLSGYWSP*TSTM*MRHPP 319 PLEVDGIDKLD+ + L LT L V S SP + R PP Sbjct: 22 PLEVDGIDKLDLAITQISLSPLYPNLTIDLHVRSNSCSPGDPLVLERPPP 71 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 388 ELVHQSKSGREFDIKLIDTVDLEG 459 E+V + +IKLIDTVDLEG Sbjct: 74 EIVEKMADHLHLEIKLIDTVDLEG 97 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLDI Sbjct: 22 PLEVDGIDKLDI 33 >SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 453 EVDGIDKLDIEF 418 EVDGIDKLDIEF Sbjct: 26 EVDGIDKLDIEF 37 >SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) Length = 213 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 418 EFDIKLIDTVDLEG 459 +F IKLIDTVDLEG Sbjct: 93 DFSIKLIDTVDLEG 106 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 459 PLEVDGIDKLDIE 421 PLEVDGIDKLD++ Sbjct: 22 PLEVDGIDKLDVK 34 >SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) Length = 1065 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 81 PLEVDGIDKLDV 92 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 373 HQVGCELVHQSKSG-REFDIKLIDTVDLEG 459 H E ++ S +G E IKLIDTVDLEG Sbjct: 12 HLDSLEELYISHNGIEEIKIKLIDTVDLEG 41 >SB_51382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 418 EFDIKLIDTVDLEG 459 + DIKLIDTVDLEG Sbjct: 200 KMDIKLIDTVDLEG 213 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALR 403 PLEVDGIDKLD+ +R Sbjct: 22 PLEVDGIDKLDLIKCGCIR 40 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAAL 406 PLEVDGIDKLD+ L Sbjct: 22 PLEVDGIDKLDLRVIVRL 39 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDV 33 >SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDV 33 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 415 REFDIKLIDTVDLEG 459 R F IKLIDTVDLEG Sbjct: 32 RGFRIKLIDTVDLEG 46 >SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDV 33 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +1 Query: 403 SKSGREFDIKLIDTVDLEG 459 S G + IKLIDTVDLEG Sbjct: 363 SYGGLHYRIKLIDTVDLEG 381 >SB_29458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDV 33 >SB_28685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 28.3 bits (60), Expect = 3.2 Identities = 26/65 (40%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAHLVLSGYWSP*TSTM*MRHPP*DISSKVSV-*LQ 283 PLEVDGIDKLD L DEL L S H P D+ S SV + Sbjct: 9 PLEVDGIDKLD-----DLASTDELETILASSTKVKAKPLQNGEIHEPSDVDSSDSVETIS 63 Query: 282 RLPHP 268 +LP P Sbjct: 64 QLPSP 68 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 28.3 bits (60), Expect = 3.2 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTAHLVLSG 364 PLEVDGIDKLD L L+ EL L LSG Sbjct: 22 PLEVDGIDKLD---PKRLLLLSEL--QLTLSG 48 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 28.3 bits (60), Expect = 3.2 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAA 409 PLEVDGIDKLD E A Sbjct: 22 PLEVDGIDKLDPELHPA 38 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 421 FDIKLIDTVDLEG 459 F+IKLIDTVDLEG Sbjct: 52 FNIKLIDTVDLEG 64 >SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 23 PLEVDGIDKLDV 34 >SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2324 Score = 28.3 bits (60), Expect = 3.2 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 1887 PLEVDGIDKLDV 1898 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 73 DIKLIDTVDLEG 84 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDELTA 382 PLEVDGIDKLD A++ + EL A Sbjct: 22 PLEVDGIDKLD---PASIETLQELYA 44 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 95 DIKLIDTVDLEG 106 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 40 DIKLIDTVDLEG 51 >SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) Length = 679 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 9 PLEVDGIDKLDL 20 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 382 GCELVHQSKS-GREFDIKLIDTVDLEG 459 G + ++S S G + IKLIDTVDLEG Sbjct: 51 GTQFKYESNSAGLDKFIKLIDTVDLEG 77 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVDEL 388 PLEVDGIDKLD A L D L Sbjct: 22 PLEVDGIDKLDHTVQKANVLDDNL 45 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +1 Query: 400 QSKSGREFDIKLIDTVDLEG 459 Q ++ + + IKLIDTVDLEG Sbjct: 15 QMENDQFYSIKLIDTVDLEG 34 >SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAAL 406 PLEVDGIDKLD AA + Sbjct: 22 PLEVDGIDKLDGPSAAVV 39 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 379 VGCELVHQSKSGREFDIKLIDTVDLEG 459 +G L + +G IKLIDTVDLEG Sbjct: 17 IGAGLFAITPAGERGMIKLIDTVDLEG 43 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 459 PLEVDGIDKLDIE 421 PLEVDGIDKLD E Sbjct: 22 PLEVDGIDKLDPE 34 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 421 FDIKLIDTVDLEG 459 F IKLIDTVDLEG Sbjct: 71 FSIKLIDTVDLEG 83 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 27 DIKLIDTVDLEG 38 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 459 PLEVDGIDKLDIEF 418 PLEVDGIDKLD + Sbjct: 22 PLEVDGIDKLDTRY 35 >SB_4964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAAL 406 PLEVDGIDKLD + AL Sbjct: 9 PLEVDGIDKLDRKTNVAL 26 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAA 409 PLEVDGIDKLD + A Sbjct: 22 PLEVDGIDKLDEDLQGA 38 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 20 DIKLIDTVDLEG 31 >SB_56357| Best HMM Match : Ank (HMM E-Value=1.2e-06) Length = 73 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 59 DIKLIDTVDLEG 70 >SB_53858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDL 33 >SB_53755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDL 33 >SB_50474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 459 PLEVDGIDKLDIE 421 PLEVDGIDKLD E Sbjct: 22 PLEVDGIDKLDEE 34 >SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 5 DIKLIDTVDLEG 16 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 87 DIKLIDTVDLEG 98 >SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 382 GCELVHQSKSGREFDIKLIDTVDLEG 459 G E + + +IKLIDTVDLEG Sbjct: 5 GGEFAYSPNQPFQHNIKLIDTVDLEG 30 >SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 21 DIKLIDTVDLEG 32 >SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 421 FDIKLIDTVDLEG 459 F IKLIDTVDLEG Sbjct: 4 FQIKLIDTVDLEG 16 >SB_28611| Best HMM Match : MAM (HMM E-Value=4.4e-22) Length = 229 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 9 PLEVDGIDKLDL 20 >SB_26020| Best HMM Match : UCR_TM (HMM E-Value=6.4) Length = 122 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAA 412 PLEVDGIDKLD + A Sbjct: 22 PLEVDGIDKLDAQCQA 37 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDL 33 >SB_17552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 27.9 bits (59), Expect = 4.3 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 376 QVGCELVHQSKSGR--EFDIKLIDTVDLEG 459 Q C L+ + E +IKLIDTVDLEG Sbjct: 36 QTACRLLSSAGYSNLIECNIKLIDTVDLEG 65 >SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDL 33 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 798 DIKLIDTVDLEG 809 >SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) Length = 244 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 9 DIKLIDTVDLEG 20 >SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1117 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 95 DIKLIDTVDLEG 106 >SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 28 DIKLIDTVDLEG 39 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 424 DIKLIDTVDLEG 459 DIKLIDTVDLEG Sbjct: 297 DIKLIDTVDLEG 308 >SB_59325| Best HMM Match : zf-CCHC (HMM E-Value=7.2) Length = 107 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 87 HQAYRYRRPRG 97 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRL 400 PLEVDGIDKLD A +++ Sbjct: 22 PLEVDGIDKLDAVTLALVQI 41 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 207 HQAYRYRRPRG 217 >SB_50679| Best HMM Match : Tombus_P19 (HMM E-Value=2.1) Length = 330 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 274 HQAYRYRRPRG 284 >SB_49689| Best HMM Match : fn3 (HMM E-Value=5.9) Length = 61 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 41 HQAYRYRRPRG 51 >SB_49234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 49 HQAYRYRRPRG 59 >SB_48128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 43 HQAYRYRRPRG 53 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 8 HQAYRYRRPRG 18 >SB_45357| Best HMM Match : Sigma_1s (HMM E-Value=5.6) Length = 322 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 125 HQAYRYRRPRG 135 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 373 HQVGCELVHQSKSGR-EFDIKLIDTVDLEG 459 H + L + +G+ +IKLIDTVDLEG Sbjct: 46 HVLTYRLFRRDLAGKLHIEIKLIDTVDLEG 75 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +1 Query: 412 GREFDIKLIDTVDLEG 459 G + IKLIDTVDLEG Sbjct: 76 GTSYIIKLIDTVDLEG 91 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 115 HQAYRYRRPRG 125 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 532 HQAYRYRRPRG 542 >SB_33473| Best HMM Match : GST_N (HMM E-Value=0.028) Length = 276 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 220 HQAYRYRRPRG 230 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 160 HQAYRYRRPRG 170 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 421 FDIKLIDTVDLEG 459 F IKLIDTVDLEG Sbjct: 81 FTIKLIDTVDLEG 93 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -1 Query: 459 PLEVDGIDKLDI 424 PLEVDGIDKLD+ Sbjct: 22 PLEVDGIDKLDM 33 >SB_21775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 35 HQAYRYRRPRG 45 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 421 FDIKLIDTVDLEG 459 F IKLIDTVDLEG Sbjct: 921 FTIKLIDTVDLEG 933 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 459 PLEVDGIDKLDIE 421 PLEVDGIDKLD + Sbjct: 22 PLEVDGIDKLDAQ 34 >SB_12448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 525 HQAYRYRRPRG 535 >SB_9745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 91 HQAYRYRRPRG 101 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 113 HQAYRYRRPRG 123 >SB_8585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 182 HQAYRYRRPRG 192 >SB_5820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 52 HQAYRYRRPRG 62 >SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) Length = 107 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 87 HQAYRYRRPRG 97 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 103 HQAYRYRRPRG 113 >SB_56836| Best HMM Match : GAF (HMM E-Value=2.8e-07) Length = 552 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 459 HQAYRYRRPRG 469 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 84 HQAYRYRRPRG 94 >SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 421 FDIKLIDTVDLEG 459 F IKLIDTVDLEG Sbjct: 30 FHIKLIDTVDLEG 42 >SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) Length = 598 Score = 27.5 bits (58), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVD 394 PLEVDGIDKLD L D Sbjct: 93 PLEVDGIDKLDFSDGTTNTLED 114 >SB_52067| Best HMM Match : Pkinase_C (HMM E-Value=6.9) Length = 57 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 37 HQAYRYRRPRG 47 >SB_46902| Best HMM Match : GYR (HMM E-Value=1.1) Length = 54 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 34 HQAYRYRRPRG 44 >SB_40896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 44 HQAYRYRRPRG 54 >SB_40844| Best HMM Match : DUF595 (HMM E-Value=6.1) Length = 194 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 138 HQAYRYRRPRG 148 >SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) Length = 374 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 233 HQAYRYRRPRG 243 >SB_39500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 41 HQAYRYRRPRG 51 >SB_38057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 147 HQAYRYRRPRG 157 >SB_34485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 27.5 bits (58), Expect = 5.6 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 459 PLEVDGIDKLDIEFAAALRLVD 394 PLEVDGIDKLD L+ D Sbjct: 22 PLEVDGIDKLDDSITKILQNQD 43 >SB_12437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 159 HQAYRYRRPRG 169 >SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 596 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 385 CELVHQSKSGREFDIKLIDTVDLEG 459 C L+H + +IKLIDTVDLEG Sbjct: 517 CVLLHSPSTPT--NIKLIDTVDLEG 539 >SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) Length = 163 Score = 27.5 bits (58), Expect = 5.6 Identities = 18/29 (62%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = -1 Query: 459 PLEVDGIDKLD-IEF--AAALRLVDELTA 382 PLEVDGIDKLD EF A RL D+ A Sbjct: 9 PLEVDGIDKLDENEFLKIQASRLEDQTKA 37 >SB_7597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 152 HQAYRYRRPRG 162 >SB_2338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 426 YQAYRYRRPRG 458 +QAYRYRRPRG Sbjct: 125 HQAYRYRRPRG 135 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,285,039 Number of Sequences: 59808 Number of extensions: 321369 Number of successful extensions: 1150 Number of sequences better than 10.0: 345 Number of HSP's better than 10.0 without gapping: 1055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1150 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -