SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0470.Seq
         (459 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY320566-1|AAQ21877.1|   77|Homo sapiens immunoglobulin kappa ch...    29   7.7  

>AY320566-1|AAQ21877.1|   77|Homo sapiens immunoglobulin kappa chain
           variable region protein.
          Length = 77

 Score = 29.1 bits (62), Expect = 7.7
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +2

Query: 260 RFEGWGSRCNYTETLELISHGGWRIYIVDVYG 355
           RF GWGS  ++T T+  +    + +Y    YG
Sbjct: 40  RFSGWGSGTDFTLTISRLEPEDFAVYYCQQYG 71


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 72,478,380
Number of Sequences: 237096
Number of extensions: 1496185
Number of successful extensions: 2221
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2180
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2221
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 3872123864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -