BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0470.Seq (459 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF026202-2|AAB71242.2| 501|Caenorhabditis elegans Hypothetical ... 27 8.7 >AF026202-2|AAB71242.2| 501|Caenorhabditis elegans Hypothetical protein C10E2.2 protein. Length = 501 Score = 26.6 bits (56), Expect = 8.7 Identities = 17/73 (23%), Positives = 28/73 (38%) Frame = +2 Query: 119 SEGITSCNKN*TRKIIICVITGGRTSWESARVGTTTPPISAVKQ*SFRFEGWGSRCNYTE 298 SE I K T + C+ T R+ + + T I + R W S C++T Sbjct: 256 SENIREIQKGGTLYTLKCLKTVRRSEYGVHCLSQHTETIDIMNDIVLRCPNWSSGCDFTS 315 Query: 299 TLELISHGGWRIY 337 T + G + + Sbjct: 316 TRVKVKVGNLKFH 328 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,140,093 Number of Sequences: 27780 Number of extensions: 232054 Number of successful extensions: 448 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 448 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 820565746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -