BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0469.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g73840.1 68414.m08549 hydroxyproline-rich glycoprotein family... 31 0.58 At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEME... 31 0.77 At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family... 29 2.4 At1g69740.1 68414.m08025 porphobilinogen synthase, putative / de... 29 2.4 At1g13050.1 68414.m01513 expressed protein 29 2.4 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 29 3.1 At4g40020.1 68417.m05666 hypothetical protein 29 3.1 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 28 4.1 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 28 4.1 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 28 5.4 At5g38560.1 68418.m04662 protein kinase family protein contains ... 27 7.2 At4g00890.1 68417.m00120 proline-rich family protein contains pr... 27 7.2 At3g61260.1 68416.m06856 DNA-binding family protein / remorin fa... 27 7.2 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 27 7.2 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 27 9.5 At2g35350.1 68415.m04334 protein phosphatase 2C family protein /... 27 9.5 At2g07360.1 68415.m00843 SH3 domain-containing protein contains ... 27 9.5 At1g26150.1 68414.m03192 protein kinase family protein similar t... 27 9.5 >At1g73840.1 68414.m08549 hydroxyproline-rich glycoprotein family protein similar to proline-rich protein precursor GB:AAC34889 [Glycine max] Length = 388 Score = 31.1 bits (67), Expect = 0.58 Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 7/67 (10%) Frame = -2 Query: 567 QRQPPKATPR-HLKRFLVVE*RKSGSGHKSATDSHPQ-PIRRAPTVPAAPIPP-----QA 409 Q PPK + H+ F + GS H+ A PQ PIR+ PT P+PP A Sbjct: 88 QSIPPKPNVQAHMSSF-----QGGGSVHEPANTMQPQAPIRKHPTPQPMPMPPPPPSVSA 142 Query: 408 RPGQAQP 388 Q+QP Sbjct: 143 NSAQSQP 149 >At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1729 Score = 30.7 bits (66), Expect = 0.77 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = -2 Query: 513 E*RKSGSGHKSATDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLP 367 E R S + SA + P P R+ T P+PP++ P A P+ + LP Sbjct: 1386 ECRHFASAYASARLALPAPEERSLTSATIPVPPESYPPVAIPMIELPLP 1434 >At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family protein identical to proline-rich protein 2 [Arabidopsis thaliana] gi|7620011|gb|AAF64549 Length = 321 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 465 PQPIRRAPTV-PAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPL 331 P PI + P V P P PP+ +P + P V +T PPL Sbjct: 219 PVPIYKPPVVIPKKPCPPKIHKPIYKPPVPIYKPPVVIPKKTFPPL 264 >At1g69740.1 68414.m08025 porphobilinogen synthase, putative / delta-aminolevulinic acid dehydratase, putative similar to delta-aminolevulinic acid dehydratase (Alad) GI:493019 [SP|P43210] from Glycine max, SP|P24493 from Spinacia oleracea, SP|P30124 from Pisum sativum Length = 430 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 5/76 (6%) Frame = -2 Query: 531 KRFLVVE*RKSGSGHK---SATDSHPQPIRRAPTVP-AAPIPPQ-ARPGQAQPLQAVLLP 367 +R LVV +SG+GH +D+ + A VP A P+PP+ A P ++ + L Sbjct: 46 RRNLVVRASESGNGHAKKLGMSDAECEAAVAAGNVPEAPPVPPKPAAPVGTPIIKPLNLS 105 Query: 366 RAVQVHRTLPPLRLVF 319 R + +R P R F Sbjct: 106 RRPRRNRASPVTRAAF 121 >At1g13050.1 68414.m01513 expressed protein Length = 317 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 468 HPQPIRRA-PTVPAAPIPPQARPGQAQPLQ 382 H P R P P P+PP+ P A+PLQ Sbjct: 65 HESPSSRPLPLRPEEPLPPRHNPNSARPLQ 94 Score = 28.3 bits (60), Expect = 4.1 Identities = 22/56 (39%), Positives = 25/56 (44%) Frame = -2 Query: 597 PAQVEELLPAQRQPPKATPRHLKRFLVVE*RKSGSGHKSATDSHPQPIRRAPTVPA 430 P + EE LP + P A P L E R G+ S P P RRAPT PA Sbjct: 74 PLRPEEPLPPRHNPNSARPLQLSP---EEQRPPHRGY----GSEPTPWRRAPTRPA 122 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = -2 Query: 465 PQPIRRAPTVPAAPIPPQARPG-QAQPLQAVLLPRAVQVHRTLPPLRLVFPG 313 P P R +P P PP P A+ L P V+ LPP L+F G Sbjct: 58 PPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYPPTRVRREAPLPPPPLIFVG 109 >At4g40020.1 68417.m05666 hypothetical protein Length = 615 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -2 Query: 534 LKRF--LVVE*RKSGSGHK--SATDSHPQPIRRAPTVPAAPIPPQA 409 ++RF L+V + HK S+TDS + + PT P+ P+PP + Sbjct: 567 IRRFGDLLVRRKSLSFSHKKESSTDSQDKQQPQTPTSPSPPLPPMS 612 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 507 RKSGSGHKSATDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLPRAVQV--HRTLPP 334 ++ G + HPQ + P +P +PP + PL LPR +Q+ H +PP Sbjct: 567 QQQGYQQQQQHQGHPQQMLPMPNMPHHQLPPSSH----MPLHPHHLPRPMQMPPHGHMPP 622 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -2 Query: 507 RKSGSGHKSATDSHPQPIRRAPTVPAAPIPPQARPGQAQPL 385 R SGS + P P R P P A P P +A+PL Sbjct: 530 RASGSRGRRPRPPLPPPARARPLPPPARARPMPPPARARPL 570 >At5g48360.1 68418.m05975 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 782 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = -2 Query: 459 PIRRAPTVPAAPIPPQAR------PGQAQPLQAVLLPRAVQVHRTLPPLRL 325 P+ +P P P+PP P + A++LPR+ + H T P L L Sbjct: 54 PLESSPPSPPPPLPPTPPTTFAVFPTFPANISALVLPRSSKPHHTSPTLLL 104 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -2 Query: 483 SATDSHPQPIRRAPTVPAAPIP--PQARPGQAQP 388 +++ + P P++ PT P+AP P P P Q+ P Sbjct: 16 NSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPP 49 >At4g00890.1 68417.m00120 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 431 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = -2 Query: 468 HPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTL 340 HPQ ++P +P+ P+++ L+ + V+ HR L Sbjct: 50 HPQSPPEPKSLPLSPLSPKSKEEPESQTMTPLMSKHVKTHRNL 92 >At3g61260.1 68416.m06856 DNA-binding family protein / remorin family protein similar to DNA-binding protein gi|601843 [Arabidopsis thaliana], remorin [Solanum tuberosum] GI:1881585; contains Pfam profiles PF03763: Remorin C-terminal region, PF03766: Remorin N-terminal region Length = 212 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 513 PPPETASDDAXSLLAVDAELEEAPP 587 PPPE DD+ +L V+ +EE P Sbjct: 57 PPPEQIFDDSKALTVVEKPVEEPAP 81 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 27.5 bits (58), Expect = 7.2 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -2 Query: 483 SATDSHPQPIRRAPTVPAAPIPPQARP--GQAQPLQAVLLPRAVQVHRTLPPLRLVFP 316 ++T + P P AP AAP P P AQP + + P V T PP V P Sbjct: 33 TSTTTAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPA-VTPTSPPAPKVAP 89 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 27.1 bits (57), Expect = 9.5 Identities = 21/90 (23%), Positives = 32/90 (35%) Frame = -2 Query: 573 PAQRQPPKATPRHLKRFLVVE*RKSGSGHKSATDSHPQPIRRAPTVPAAPIPPQARPGQA 394 P+ P + P F + G+ + T P P P P P Q P Q Sbjct: 155 PSPPSPMEEVPIDFPFFFAPPPQNIGASPPTETQVIPNPS------PVPPPPAQPPPAQT 208 Query: 393 QPLQAVLLPRAVQVHRTLPPLRLVFPGVII 304 P Q +P AV ++ + GV++ Sbjct: 209 PPPQLSEVPHAVNKKKSHKSKMYIIVGVLV 238 >At2g35350.1 68415.m04334 protein phosphatase 2C family protein / PP2C family protein similar to protein phosphatase-2c (GI:3608412) [Mesembryanthemum crystallinum]; contains Pfam PF00481 : Protein phosphatase 2C domain Length = 783 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 153 NLKHYKEYSKSCLVVLNTDILTEMVRNIEYVFEARHIFP 269 +L+HY+ +VL++D L + + N+E V A FP Sbjct: 683 SLRHYRLTENDQFMVLSSDGLYQYLSNVEVVSLAMEKFP 721 >At2g07360.1 68415.m00843 SH3 domain-containing protein contains Pfam profile PF00018: SH3 domain Length = 1196 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = -2 Query: 507 RKSGSGHKSATDSHPQPIRRAPTVPAAPIPPQARPGQAQPL 385 + GS ++S + + PIR P P + PQ+R P+ Sbjct: 1075 KSGGSKYQSTYEGYGSPIREEPPPPYSYSEPQSRESFENPV 1115 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -2 Query: 492 GHKSATDSHPQPI-RRAPTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPLRLVFP 316 G K T S P P + P P+ P PP+ +P L + LPP +V P Sbjct: 235 GSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSP 294 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,055,299 Number of Sequences: 28952 Number of extensions: 249740 Number of successful extensions: 839 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -