BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0468.Seq (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) 76 3e-14 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_5361| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_19978| Best HMM Match : DUF229 (HMM E-Value=0.00021) 28 5.7 >SB_35685| Best HMM Match : Ribosomal_S8 (HMM E-Value=0.08) Length = 120 Score = 75.8 bits (178), Expect = 3e-14 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 411 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKH 280 MVR+NVL+DAL SI NAEKRGKRQV IRP SKVIVKFLTVMMKH Sbjct: 1 MVRVNVLNDALVSICNAEKRGKRQVQIRPSSKVIVKFLTVMMKH 44 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/28 (78%), Positives = 25/28 (89%), Gaps = 1/28 (3%) Frame = -3 Query: 199 CGVISPRFDVPINDIERW-TNLLPSRQF 119 CGVISPRFDV + DIE+W +NLLPSRQF Sbjct: 1 CGVISPRFDVGVRDIEQWASNLLPSRQF 28 >SB_54474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -1 Query: 378 KSIHNAEKRGKRQVLIRPCSKVIVKFL--TVMMKHGYIGEFEIV 253 K+IHN RGKR +++ V F TV+M++G F++V Sbjct: 17 KNIHNVNVRGKRGNIVQVYPAVEYDFTPNTVLMRNGDYVHFQLV 60 >SB_5361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1562 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +3 Query: 546 DLHSICLASHSTADASSLMYVAPIFSLCFGDRTC 647 DLH ++ HST SS A IF+ DRTC Sbjct: 1239 DLHKALMSLHSTDKPSSDYKQAGIFAKIPADRTC 1272 >SB_19978| Best HMM Match : DUF229 (HMM E-Value=0.00021) Length = 552 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +3 Query: 546 DLHSICLASHSTADASSLMYVAPIFSLCFGDRTC 647 DLH ++ HST SS A IF+ DRTC Sbjct: 241 DLHKALMSLHSTDKPSSDYKQAGIFAKIPADRTC 274 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,723,965 Number of Sequences: 59808 Number of extensions: 364412 Number of successful extensions: 1975 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1974 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -