BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0468.Seq (648 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal pro... 139 2e-33 Z81066-3|CAI46608.1| 363|Caenorhabditis elegans Hypothetical pr... 27 8.7 >AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 22 protein. Length = 130 Score = 139 bits (336), Expect = 2e-33 Identities = 64/77 (83%), Positives = 71/77 (92%), Gaps = 1/77 (1%) Frame = -3 Query: 253 DDHRAGKIVVNLTGRLNKCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLTTSGGIMDH 77 DDHRAGKIVVNLTGRLNK VISPR ++ +ND+E++TN LLPSRQFGYL+LTTS GIMDH Sbjct: 54 DDHRAGKIVVNLTGRLNKASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDH 113 Query: 76 EEARRKHLGGKILGFFF 26 EEARRKHLGGKILGFFF Sbjct: 114 EEARRKHLGGKILGFFF 130 Score = 99.1 bits (236), Expect = 2e-21 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -1 Query: 411 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKHGYIGEFEIV 253 MVRMNVL+DAL +I+NAEKRGKRQVLIRP SKVIV+FLTVMMKHGYIGEFEIV Sbjct: 1 MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIV 53 >Z81066-3|CAI46608.1| 363|Caenorhabditis elegans Hypothetical protein F17B5.6 protein. Length = 363 Score = 27.5 bits (58), Expect = 8.7 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 1/14 (7%) Frame = -2 Query: 128 TTVWL-PSPYNKWW 90 T +WL P PYN WW Sbjct: 29 TVIWLIPRPYNYWW 42 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,032,067 Number of Sequences: 27780 Number of extensions: 272499 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1434198608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -