BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0464.Seq (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.8 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 8.5 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 255 VVPTHAGLLTTLAPVITQIL 314 V+PT AGL TT A V +++ Sbjct: 1258 VIPTPAGLKTTGAAVYARVI 1277 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 21.4 bits (43), Expect = 8.5 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 352 TFIVEDVHESVKYADSTKKNCLRDLNIDIVLSLNINTNMADVLTF 486 T I+ + HE+VKY K NI + + AD+LTF Sbjct: 52 TEIINETHENVKYLPGHK----LPPNIIAIPDVVEAAKDADILTF 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,700 Number of Sequences: 438 Number of extensions: 2936 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -