BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0463.Seq (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51698| Best HMM Match : COX6C (HMM E-Value=1e-07) 44 1e-04 SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 >SB_51698| Best HMM Match : COX6C (HMM E-Value=1e-07) Length = 187 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/47 (44%), Positives = 31/47 (65%) Frame = -1 Query: 249 IKRNIIVALALSGVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEM 109 +K++I+ A VAG +K L + K+KYA+FY+ YDAEK +EM Sbjct: 134 LKKDILHASIAGIVAGCAWKFLYADPLKKKYADFYKNYDAEKVAKEM 180 >SB_56816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = +1 Query: 166 LALITNELLEGKTSDARESQSNNNVTF---DDGLR 261 L+ + NEL E + +E Q NNNVTF D+GLR Sbjct: 94 LSRLVNELFE----EVQEKQINNNVTFGPLDEGLR 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,999,783 Number of Sequences: 59808 Number of extensions: 369983 Number of successful extensions: 885 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -