BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0463.Seq (648 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X13238-1|CAA31624.1| 75|Homo sapiens cytochrome c oxidase subu... 58 2e-08 BT007007-1|AAP35653.1| 75|Homo sapiens cytochrome c oxidase su... 58 2e-08 BC000187-1|AAH00187.1| 75|Homo sapiens cytochrome c oxidase su... 58 2e-08 AF067637-1|AAC73061.1| 75|Homo sapiens cytochrome c oxidase su... 58 2e-08 >X13238-1|CAA31624.1| 75|Homo sapiens cytochrome c oxidase subunit VIc preprotein protein. Length = 75 Score = 58.4 bits (135), Expect = 2e-08 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = -1 Query: 249 IKRNIIVALALS-GVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGLFQS 85 ++ ++ VA LS GVA +K + ++RK+ YA+FYR YD K+FEEMRK G+FQS Sbjct: 19 LRNHMAVAFVLSLGVAAL-YKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQS 73 >BT007007-1|AAP35653.1| 75|Homo sapiens cytochrome c oxidase subunit VIc protein. Length = 75 Score = 58.4 bits (135), Expect = 2e-08 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = -1 Query: 249 IKRNIIVALALS-GVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGLFQS 85 ++ ++ VA LS GVA +K + ++RK+ YA+FYR YD K+FEEMRK G+FQS Sbjct: 19 LRNHMAVAFVLSLGVAAL-YKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQS 73 >BC000187-1|AAH00187.1| 75|Homo sapiens cytochrome c oxidase subunit VIc protein. Length = 75 Score = 58.4 bits (135), Expect = 2e-08 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = -1 Query: 249 IKRNIIVALALS-GVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGLFQS 85 ++ ++ VA LS GVA +K + ++RK+ YA+FYR YD K+FEEMRK G+FQS Sbjct: 19 LRNHMAVAFVLSLGVAAL-YKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQS 73 >AF067637-1|AAC73061.1| 75|Homo sapiens cytochrome c oxidase subunit VIc protein. Length = 75 Score = 58.4 bits (135), Expect = 2e-08 Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = -1 Query: 249 IKRNIIVALALS-GVAGFTFKQLIGNERKRKYAEFYRTYDAEKEFEEMRKKGLFQS 85 ++ ++ VA LS GVA +K + ++RK+ YA+FYR YD K+FEEMRK G+FQS Sbjct: 19 LRNHMAVAFVLSLGVAAL-YKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQS 73 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,174,634 Number of Sequences: 237096 Number of extensions: 1807908 Number of successful extensions: 3045 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3045 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7197658880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -