BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0461.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 41 6e-04 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 41 6e-04 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 41 6e-04 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 41 6e-04 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 41 6e-04 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 41 6e-04 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 41 6e-04 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) 38 0.007 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_26020| Best HMM Match : UCR_TM (HMM E-Value=6.4) 37 0.009 SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 37 0.012 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_15196| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 37 0.012 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 37 0.012 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) 37 0.012 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 37 0.012 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 37 0.012 SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) 36 0.017 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 36 0.017 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 36 0.017 SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) 36 0.017 SB_29458| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 36 0.017 SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.017 SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) 36 0.022 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_21862| Best HMM Match : ABC_membrane_2 (HMM E-Value=1) 36 0.022 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_53858| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_53755| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_50474| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_28611| Best HMM Match : MAM (HMM E-Value=4.4e-22) 36 0.022 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 36 0.029 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.029 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 36 0.029 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 36 0.029 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.029 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.029 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.029 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 36 0.029 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 36 0.029 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.029 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 35 0.038 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 35 0.038 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 35 0.038 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_38866| Best HMM Match : HHH (HMM E-Value=0.00018) 35 0.038 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) 35 0.038 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 35 0.038 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 35 0.038 SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 35 0.038 SB_4964| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) 35 0.038 SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) 35 0.038 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_48920| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_48851| Best HMM Match : zf-C2H2 (HMM E-Value=3.2e-13) 35 0.038 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 35 0.038 SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_34485| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_34258| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 35 0.038 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_30561| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 35 0.038 SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_28685| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 35 0.038 SB_21460| Best HMM Match : GAS2 (HMM E-Value=0.0008) 35 0.038 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 35 0.038 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) 35 0.038 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 35 0.038 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_829| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.038 SB_279| Best HMM Match : rve (HMM E-Value=3.2) 35 0.038 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.067 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 33 0.12 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 33 0.12 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 33 0.15 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 33 0.15 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 33 0.20 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_45222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) 32 0.27 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09) 32 0.36 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 31 0.47 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_44598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_51382| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 31 0.62 SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 31 0.62 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) 31 0.82 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 31 0.82 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_56357| Best HMM Match : Ank (HMM E-Value=1.2e-06) 31 0.82 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_24639| Best HMM Match : OEP (HMM E-Value=1.1) 31 0.82 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 31 0.82 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 31 0.82 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 30 1.1 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_21395| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 30 1.1 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 30 1.1 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) 30 1.1 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 30 1.1 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 30 1.4 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 30 1.4 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 30 1.4 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 30 1.4 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 30 1.4 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.4 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 30 1.4 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 30 1.4 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 30 1.4 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 30 1.4 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 30 1.4 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 30 1.4 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 30 1.4 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 30 1.4 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 30 1.4 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 30 1.4 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 30 1.4 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 30 1.4 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 30 1.4 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 30 1.4 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 30 1.4 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 30 1.4 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 30 1.4 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 30 1.4 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 30 1.4 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 30 1.4 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 30 1.4 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 30 1.4 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 30 1.4 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 30 1.4 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 30 1.4 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 30 1.4 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 30 1.4 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 30 1.4 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 30 1.4 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.5 bits (93), Expect = 4e-04 Identities = 20/23 (86%), Positives = 20/23 (86%), Gaps = 1/23 (4%) Frame = -1 Query: 482 IGRI-GTGPPXEVDGIDKLDIEF 417 IG I GTGPP EVDGIDKLDIEF Sbjct: 13 IGTIAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.5 bits (93), Expect = 4e-04 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -3 Query: 546 TPGFSQSRRCKXXPVNCNXTHYRSNW 469 TPGF K PVNCN THYR+NW Sbjct: 55 TPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 3 KAGTGPPLEVDGIDKLDIEF 22 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +1 Query: 469 PIRPIVSRITIHWRXF 516 PIRPIVS ITIHW F Sbjct: 41 PIRPIVSHITIHWPSF 56 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 21 KAGTGPPLEVDGIDKLDIEF 40 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 46 KAGTGPPLEVDGIDKLDIEF 65 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 99 LQRRDWENPGV 109 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 18 KAGTGPPLEVDGIDKLDIEF 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 3 KAGTGPPLEVDGIDKLDIEF 22 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 56 LQRRDWENPGV 66 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 21 KAGTGPPLEVDGIDKLDIEF 40 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 27.9 bits (59), Expect = 5.8 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQR DWENPGV Sbjct: 69 LQRHDWENPGV 79 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 5 KAGTGPPLEVDGIDKLDIEF 24 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 54 KAGTGPPLEVDGIDKLDIEF 73 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 107 LQRRDWENPGV 117 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLDIEF Sbjct: 16 KAGTGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP E+DGIDKLDIEF Sbjct: 3 KAGTGPPLELDGIDKLDIEF 22 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 56 LQRRDWENPGV 66 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + G+GPP EVDGIDKLDIEF Sbjct: 16 KAGSGPPLEVDGIDKLDIEF 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.7 bits (86), Expect = 0.003 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + G GPP EVDGIDKLDIEF Sbjct: 16 KAGPGPPLEVDGIDKLDIEF 35 >SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 38.3 bits (85), Expect = 0.004 Identities = 14/20 (70%), Positives = 18/20 (90%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLD+++ Sbjct: 16 KAGTGPPLEVDGIDKLDVQY 35 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.9 bits (84), Expect = 0.005 Identities = 21/37 (56%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +3 Query: 363 RTXAPPTPXXAISLRSG---REFDIKLIDTVDLXGGP 464 R APP A+ L +EFDIKLIDTVDL GGP Sbjct: 47 RIGAPPQVAPALELVDPPGLQEFDIKLIDTVDLEGGP 83 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -3 Query: 546 TPGFSQSRRCKXXPVNCNXTHYRSNW 469 TP F K PVNCN THYR+NW Sbjct: 1874 TPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) Length = 1065 Score = 37.5 bits (83), Expect = 0.007 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = -1 Query: 491 RLTIGRIGTGPPXEVDGIDKLDI 423 ++T + GTGPP EVDGIDKLD+ Sbjct: 70 KITGTKAGTGPPLEVDGIDKLDV 92 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 37.5 bits (83), Expect = 0.007 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLDI+ Sbjct: 16 KAGTGPPLEVDGIDKLDID 34 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 108 LQRRDWENPGV 118 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.1 bits (82), Expect = 0.009 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFAXATQ 402 + GTGPP EVDGIDKLD E +Q Sbjct: 16 KAGTGPPLEVDGIDKLDPESGRGSQ 40 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 78 LQRRDWENPGV 88 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 37.1 bits (82), Expect = 0.009 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD++ Sbjct: 16 KAGTGPPLEVDGIDKLDVD 34 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 107 LQRRDWENPGV 117 >SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 37.1 bits (82), Expect = 0.009 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD++ Sbjct: 16 KAGTGPPLEVDGIDKLDVD 34 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 116 LQRRDWENPGV 126 >SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 37.1 bits (82), Expect = 0.009 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFAXATQ 402 + GTGPP EVDGIDKLDI + Q Sbjct: 3 KAGTGPPLEVDGIDKLDITTSAPVQ 27 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 80 LQRRDWENPGV 90 >SB_26020| Best HMM Match : UCR_TM (HMM E-Value=6.4) Length = 122 Score = 37.1 bits (82), Expect = 0.009 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFAXATQ*Y 396 + GTGPP EVDGIDKLD + T+ Y Sbjct: 16 KAGTGPPLEVDGIDKLDAQCQAFTEEY 42 >SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.1 bits (82), Expect = 0.009 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD++ Sbjct: 16 KAGTGPPLEVDGIDKLDVD 34 >SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 37.1 bits (82), Expect = 0.009 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFAXA 408 + GTGPP EVDGIDKLD F A Sbjct: 16 KAGTGPPLEVDGIDKLDAVFLTA 38 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 98 LQRRDWENPGV 108 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 540 GFSQSRRCKXXPVNCNXTHYRSNW 469 GF K PVNCN THYR+NW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLDI Sbjct: 16 KAGTGPPLEVDGIDKLDI 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 101 LQRRDWENPGV 111 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 540 GFSQSRRCKXXPVNCNXTHYRSNW 469 GF K PVNCN THYR+NW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 423 DIKLIDTVDLXGGP 464 +IKLIDTVDL GGP Sbjct: 219 NIKLIDTVDLEGGP 232 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 540 GFSQSRRCKXXPVNCNXTHYRSNW 469 GF K PVNCN THYR+NW Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 Query: 426 IKLIDTVDLXGGP 464 IKLIDTVDL GGP Sbjct: 550 IKLIDTVDLEGGP 562 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLDI Sbjct: 16 KAGTGPPLEVDGIDKLDI 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 103 LQRRDWENPGV 113 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 540 GFSQSRRCKXXPVNCNXTHYRSNW 469 GF K PVNCN THYR+NW Sbjct: 36 GFPSHDVVKRRPVNCNTTHYRANW 59 >SB_15196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD++ Sbjct: 16 KAGTGPPLEVDGIDKLDVK 34 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLDI Sbjct: 16 KAGTGPPLEVDGIDKLDI 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 138 LQRRDWENPGV 148 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 36.7 bits (81), Expect = 0.012 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFA 414 + GTGPP EVDGIDKLD E A Sbjct: 16 KAGTGPPLEVDGIDKLDPEAA 36 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 108 LQRRDWENPGV 118 >SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD E Sbjct: 16 KAGTGPPLEVDGIDKLDAE 34 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLDI Sbjct: 16 KAGTGPPLEVDGIDKLDI 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 103 LQRRDWENPGV 113 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD++ Sbjct: 16 KAGTGPPLEVDGIDKLDLD 34 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 84 LQRRDWENPGV 94 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 540 GFSQSRRCKXXPVNCNXTHYRSNW 469 GF K PVNCN THYR+NW Sbjct: 79 GFPSHDVVKRRPVNCNTTHYRANW 102 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -1 Query: 545 RQGFPSHDVVNXR 507 RQGFPSHDVV R Sbjct: 77 RQGFPSHDVVKRR 89 >SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) Length = 137 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFAXA 408 + GTGPP EVDGIDKLD+ A Sbjct: 16 KAGTGPPLEVDGIDKLDVTLKTA 38 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD++ Sbjct: 16 KAGTGPPLEVDGIDKLDVK 34 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 540 GFSQSRRCKXXPVNCNXTHYRSNW 469 GF K PVNCN THYR+NW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 36.7 bits (81), Expect = 0.012 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 540 GFSQSRRCKXXPVNCNXTHYRSNW 469 GF K PVNCN THYR+NW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) Length = 151 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDV 33 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 36.3 bits (80), Expect = 0.017 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFAXATQ 402 + GTGPP EVDGIDKLD + A++ Sbjct: 16 KAGTGPPLEVDGIDKLDEDLQGASK 40 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 147 LQRRDWENPGV 157 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 36.3 bits (80), Expect = 0.017 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 464 GPPXEVDGIDKLDIEF 417 GPP EVDGIDKLDIEF Sbjct: 21 GPPLEVDGIDKLDIEF 36 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 70 LQRRDWENPGV 80 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDV 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 129 LQRRDWENPGV 139 >SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDV 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 108 LQRRDWENPGV 118 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +1 Query: 469 PIRPIVSRITIHWRXFTTS*LGK 537 PIRPIVSRITIHW F + GK Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGK 61 >SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDV 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 96 LQRRDWENPGV 106 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.017 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -2 Query: 523 TL*TXASEL*XDSL*VELGPGPPLRSTVSISLISNS 416 T+ T +S+L +L PGPP RSTVSISLISNS Sbjct: 2 TMITPSSKLTLTKGIQKLVPGPPSRSTVSISLISNS 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) Length = 197 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDV 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 110 LQRRDWENPGV 120 >SB_29458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDV 33 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 36.3 bits (80), Expect = 0.017 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -1 Query: 464 GPPXEVDGIDKLDIEF 417 GPP EVDGIDKLDIEF Sbjct: 21 GPPLEVDGIDKLDIEF 36 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 70 LQRRDWENPGV 80 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFAXA 408 + GTGPP EVDGIDKLD E A Sbjct: 16 KAGTGPPLEVDGIDKLDPELHPA 38 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 134 LQRRDWENPGV 144 >SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 17 KAGTGPPLEVDGIDKLDV 34 >SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.3 bits (80), Expect = 0.017 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEFAXAT 405 + GTGPP EVDGIDKLD A T Sbjct: 16 KAGTGPPLEVDGIDKLDTLIAYKT 39 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 106 LQRRDWENPGV 116 >SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2324 Score = 36.3 bits (80), Expect = 0.017 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 1881 KAGTGPPLEVDGIDKLDV 1898 >SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) Length = 679 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 3 KAGTGPPLEVDGIDKLDL 20 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDL 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 106 LQRRDWENPGV 116 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDL 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 127 LQRRDWENPGV 137 >SB_21862| Best HMM Match : ABC_membrane_2 (HMM E-Value=1) Length = 140 Score = 35.9 bits (79), Expect = 0.022 Identities = 16/26 (61%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -1 Query: 500 IVXRLTIG-RIGTGPPXEVDGIDKLD 426 +V + +G + GTGPP EVDGIDKLD Sbjct: 47 LVCSMPLGTKAGTGPPLEVDGIDKLD 72 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIEF 417 + GTGPP EVDGIDKLD + Sbjct: 16 KAGTGPPLEVDGIDKLDTRY 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 117 LQRRDWENPGV 127 >SB_53858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDL 33 >SB_53755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDL 33 >SB_50474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 35.9 bits (79), Expect = 0.022 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD E Sbjct: 16 KAGTGPPLEVDGIDKLDEE 34 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 70 LQRRDWENPGV 80 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDL 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 91 LQRRDWENPGV 101 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.022 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -2 Query: 475 ELGPGPPLRSTVSISLISNS 416 +L PGPP RSTVSISLISNS Sbjct: 18 KLVPGPPSRSTVSISLISNS 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_28611| Best HMM Match : MAM (HMM E-Value=4.4e-22) Length = 229 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 3 KAGTGPPLEVDGIDKLDL 20 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDL 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 123 LQRRDWENPGV 133 >SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 35.9 bits (79), Expect = 0.022 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDL 33 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.022 Identities = 21/36 (58%), Positives = 24/36 (66%) Frame = -2 Query: 523 TL*TXASEL*XDSL*VELGPGPPLRSTVSISLISNS 416 T+ T +S+L L PGPP RSTVSISLISNS Sbjct: 2 TMITPSSKLTLTKGNKSLVPGPPSRSTVSISLISNS 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.029 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 472 LGPGPPLRSTVSISLISNS 416 L PGPP RSTVSISLISNS Sbjct: 19 LVPGPPSRSTVSISLISNS 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 35.5 bits (78), Expect = 0.029 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP EVDGIDKLD+ Sbjct: 16 KAGTGPPLEVDGIDKLDM 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 108 LQRRDWENPGV 118 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 35.5 bits (78), Expect = 0.029 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDIE 420 + GTGPP EVDGIDKLD + Sbjct: 16 KAGTGPPLEVDGIDKLDAQ 34 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 133 LQRRDWENPGV 143 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 116 QEFDIKLIDTVDLEGGP 132 Score = 31.5 bits (68), Expect = 0.47 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 540 GFSQSRRCKXXPVNCNXTHYRSN 472 GF K PVNCN THYR+N Sbjct: 75 GFPSHDGEKRRPVNCNTTHYRAN 97 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.029 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 472 LGPGPPLRSTVSISLISNS 416 L PGPP RSTVSISLISNS Sbjct: 19 LVPGPPSRSTVSISLISNS 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.5 bits (78), Expect = 0.029 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 486 ESXYNSLAXVYNVVTGKT 539 ES YNSLA VYNVVTGKT Sbjct: 2 ESYYNSLAVVYNVVTGKT 19 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.029 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 472 LGPGPPLRSTVSISLISNS 416 L PGPP RSTVSISLISNS Sbjct: 19 LVPGPPSRSTVSISLISNS 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.029 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 472 LGPGPPLRSTVSISLISNS 416 L PGPP RSTVSISLISNS Sbjct: 19 LVPGPPSRSTVSISLISNS 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +EFDIKLIDTVDL GGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 35.5 bits (78), Expect = 0.029 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -2 Query: 472 LGPGPPLRSTVSISLISNS 416 L PGPP RSTVSISLISNS Sbjct: 17 LVPGPPSRSTVSISLISNS 35 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 69 LQRRDWENPGV 79 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 220 LQRRDWENPGV 230 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 115 LQRRDWENPGV 125 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 118 LQRRDWENPGV 128 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) Length = 129 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) Length = 143 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 151 LQRRDWENPGV 161 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 100 LQRRDWENPGV 110 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 130 LQRRDWENPGV 140 >SB_38866| Best HMM Match : HHH (HMM E-Value=0.00018) Length = 120 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 117 LQRRDWENPGV 127 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3433 KAGTGPPLEVDGIDKLD 3449 >SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 87 LQRRDWENPGV 97 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 96 LQRRDWENPGV 106 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 132 LQRRDWENPGV 142 >SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) Length = 199 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 113 LQRRDWENPGV 123 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 108 LQRRDWENPGV 118 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 35.1 bits (77), Expect = 0.038 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 516 KXXPVNCNXTHYRSNW 469 K PVNCN THYR+NW Sbjct: 6 KRRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 35.1 bits (77), Expect = 0.038 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 516 KXXPVNCNXTHYRSNW 469 K PVNCN THYR+NW Sbjct: 46 KRRPVNCNTTHYRANW 61 >SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 103 LQRRDWENPGV 113 >SB_4964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 126 LQRRDWENPGV 136 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 35.1 bits (77), Expect = 0.038 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 516 KXXPVNCNXTHYRSNW 469 K PVNCN THYR+NW Sbjct: 44 KRRPVNCNTTHYRANW 59 >SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) Length = 598 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 87 KAGTGPPLEVDGIDKLD 103 >SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) Length = 93 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 74 LQRRDWENPGV 84 >SB_48920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 72 LQRRDWENPGV 82 >SB_48851| Best HMM Match : zf-C2H2 (HMM E-Value=3.2e-13) Length = 169 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 104 LQRRDWENPGV 114 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 35.1 bits (77), Expect = 0.038 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 516 KXXPVNCNXTHYRSNW 469 K PVNCN THYR+NW Sbjct: 6 KRRPVNCNTTHYRANW 21 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 423 DIKLIDTVDLXGGP 464 +IKLIDTVDL GGP Sbjct: 86 EIKLIDTVDLEGGP 99 >SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 123 LQRRDWENPGV 133 >SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 79 LQRRDWENPGV 89 >SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 >SB_34485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_34258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 112 LQRRDWENPGV 122 >SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) Length = 200 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 114 LQRRDWENPGV 124 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_30561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 66 LQRRDWENPGV 76 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 35.1 bits (77), Expect = 0.038 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 516 KXXPVNCNXTHYRSNW 469 K PVNCN THYR+NW Sbjct: 38 KRRPVNCNTTHYRANW 53 >SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 >SB_28685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 >SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 106 LQRRDWENPGV 116 >SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 104 LQRRDWENPGV 114 >SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) Length = 999 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 805 KAGTGPPLEVDGIDKLD 821 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 728 LQRRDWENPGV 738 >SB_21460| Best HMM Match : GAS2 (HMM E-Value=0.0008) Length = 123 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) Length = 212 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 125 LQRRDWENPGV 135 >SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 141 LQRRDWENPGV 151 >SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) Length = 168 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 >SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) Length = 163 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 104 LQRRDWENPGV 114 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 35.1 bits (77), Expect = 0.038 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 516 KXXPVNCNXTHYRSNW 469 K PVNCN THYR+NW Sbjct: 52 KRRPVNCNTTHYRANW 67 >SB_829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 16 KAGTGPPLEVDGIDKLD 32 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 62 LQRRDWENPGV 72 >SB_279| Best HMM Match : rve (HMM E-Value=3.2) Length = 188 Score = 35.1 bits (77), Expect = 0.038 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKLD Sbjct: 3 KAGTGPPLEVDGIDKLD 19 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 102 LQRRDWENPGV 112 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 34.3 bits (75), Expect = 0.067 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +3 Query: 399 SLRSGREFDIKLIDTVDLXGGP 464 +L+S ++ DIKLIDTVDL GGP Sbjct: 69 TLKSRQKTDIKLIDTVDLEGGP 90 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 503 TGXXLQRRDWENPGV 547 TG LQRRDWENPGV Sbjct: 15 TGRRLQRRDWENPGV 29 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 503 TGXXLQRRDWENPGV 547 TG LQRRDWENPGV Sbjct: 344 TGRHLQRRDWENPGV 358 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 503 TGXXLQRRDWENPGV 547 TG LQRRDWENPGV Sbjct: 35 TGRRLQRRDWENPGV 49 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 503 TGXXLQRRDWENPGV 547 TG LQRRDWENPGV Sbjct: 25 TGRRLQRRDWENPGV 39 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 503 TGXXLQRRDWENPGV 547 TG LQRRDWENPGV Sbjct: 45 TGRRLQRRDWENPGV 59 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 503 TGXXLQRRDWENPGV 547 TG LQRRDWENPGV Sbjct: 72 TGRRLQRRDWENPGV 86 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +3 Query: 396 ISLRSGREFDIKLIDTVDLXGGP 464 I+L R F IKLIDTVDL GGP Sbjct: 26 IALDKDRGFRIKLIDTVDLEGGP 48 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 33.5 bits (73), Expect = 0.12 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLD 426 + GTGPP EVDGIDKL+ Sbjct: 404 KAGTGPPLEVDGIDKLE 420 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.15 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 +++DIKLIDTVDL GGP Sbjct: 34 KKYDIKLIDTVDLEGGP 50 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 33.1 bits (72), Expect = 0.15 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = -1 Query: 464 GPPXEVDGIDKLDIEF 417 G P EVDGIDKLDIEF Sbjct: 22 GAPLEVDGIDKLDIEF 37 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 71 LQRRDWENPGV 81 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 33.1 bits (72), Expect = 0.15 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 423 DIKLIDTVDLXGGPG 467 DIKLIDTVDL GGPG Sbjct: 297 DIKLIDTVDLEGGPG 311 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.7 bits (71), Expect = 0.20 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = +3 Query: 381 TPXXAISLRSGREFDIKLIDTVDLXGGP 464 TP + S E IKLIDTVDL GGP Sbjct: 7 TPEVQRQIISEMEISIKLIDTVDLEGGP 34 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 414 REFDIKLIDTVDLXGG 461 +EFDIKLIDTVDL GG Sbjct: 21 QEFDIKLIDTVDLEGG 36 >SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) Length = 213 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 402 LRSGREFDIKLIDTVDLXGGP 464 +R +F IKLIDTVDL GGP Sbjct: 88 IRRFNDFSIKLIDTVDLEGGP 108 >SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.20 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 414 REFDIKLIDTVDLXGGP 464 R+ DIKLIDTVDL GGP Sbjct: 9 RKVDIKLIDTVDLEGGP 25 >SB_45222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 37 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 402 LRSGREFDIKLIDTVDLXGGP 464 L+ +++ IKLIDTVDL GGP Sbjct: 16 LKKAKDYFIKLIDTVDLEGGP 36 >SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +3 Query: 399 SLRSGREFDIKLIDTVDLXGGP 464 +L+ GRE IKLIDTVDL GGP Sbjct: 109 ALKQGRE--IKLIDTVDLEGGP 128 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 546 TPGFSQSRRCKXXPV 502 TPGFSQSRRCK PV Sbjct: 34 TPGFSQSRRCKRRPV 48 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 32.3 bits (70), Expect = 0.27 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 411 GREFDIKLIDTVDLXGGP 464 GR+ IKLIDTVDL GGP Sbjct: 53 GRKVKIKLIDTVDLEGGP 70 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 546 TPGFSQSRRCKXXPV 502 TPGFSQSRRCK PV Sbjct: 34 TPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 546 TPGFSQSRRCKXXPV 502 TPGFSQSRRCK PV Sbjct: 34 TPGFSQSRRCKRRPV 48 >SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) Length = 2200 Score = 32.3 bits (70), Expect = 0.27 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = +3 Query: 393 AISLRSGREFDIKLIDTVDLXGGPG 467 A S +S IKLIDTVDL GGPG Sbjct: 473 AYSYKSLSSAKIKLIDTVDLEGGPG 497 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 546 TPGFSQSRRCKXXPV 502 TPGFSQSRRCK PV Sbjct: 34 TPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 546 TPGFSQSRRCKXXPV 502 TPGFSQSRRCK PV Sbjct: 34 TPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 546 TPGFSQSRRCKXXPV 502 TPGFSQSRRCK PV Sbjct: 34 TPGFSQSRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 546 TPGFSQSRRCKXXPV 502 TPGFSQSRRCK PV Sbjct: 34 TPGFSQSRRCKRRPV 48 >SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09) Length = 1248 Score = 31.9 bits (69), Expect = 0.36 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -2 Query: 475 ELGPGPPLRSTVSISLISNSRPLRS 401 +L PGPP RSTVSISLI + RS Sbjct: 1078 KLVPGPPSRSTVSISLILDCNASRS 1102 >SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 31.9 bits (69), Expect = 0.36 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +3 Query: 408 SGREFDIKLIDTVDLXGGP 464 + + F+IKLIDTVDL GGP Sbjct: 2 NAQRFNIKLIDTVDLEGGP 20 >SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 31.5 bits (68), Expect = 0.47 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 506 GXXLQRRDWENPGV 547 G LQRRDWENPGV Sbjct: 9 GVVLQRRDWENPGV 22 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 31.5 bits (68), Expect = 0.47 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +3 Query: 393 AISLRSGREFDIKLIDTVDLXGGP 464 A+ L F IKLIDTVDL GGP Sbjct: 62 ALRLEYYTAFSIKLIDTVDLEGGP 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.47 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +3 Query: 411 GREFDIKLIDTVDLXGGP 464 GR+ IKLIDTVDL GGP Sbjct: 21 GRDVLIKLIDTVDLEGGP 38 >SB_44598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 31.5 bits (68), Expect = 0.47 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +3 Query: 393 AISLRSGREF-DIKLIDTVDLXGGP 464 A+ +S R F DIKLIDTVDL GGP Sbjct: 37 ALVQKSKRCFTDIKLIDTVDLEGGP 61 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.5 bits (68), Expect = 0.47 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +1 Query: 472 IRPIVSRITIHWRXF 516 IRPIVSRITIHW F Sbjct: 18 IRPIVSRITIHWPSF 32 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 0.47 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 Query: 472 IRPIVSRITIHWRXFTTS*LGK 537 +RP+VSRITIHW F GK Sbjct: 33 LRPVVSRITIHWTSFYNVVTGK 54 >SB_51382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 31.1 bits (67), Expect = 0.62 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +3 Query: 417 EFDIKLIDTVDLXGGP 464 + DIKLIDTVDL GGP Sbjct: 200 KMDIKLIDTVDLEGGP 215 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 31.1 bits (67), Expect = 0.62 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +3 Query: 405 RSGREFDIKLIDTVDLXGGP 464 +S R IKLIDTVDL GGP Sbjct: 18 KSSRTSTIKLIDTVDLEGGP 37 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.1 bits (67), Expect = 0.62 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +3 Query: 399 SLRSGREFDIKLIDTVDLXGGP 464 S+R E IKLIDTVDL GGP Sbjct: 71 SIRRNYEDVIKLIDTVDLEGGP 92 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 31.1 bits (67), Expect = 0.62 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = +3 Query: 393 AISLRSGREFDIKLIDTVDLXGGP 464 A+++++ + IKLIDTVDL GGP Sbjct: 721 AVNIKASQSGLIKLIDTVDLEGGP 744 >SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 31.1 bits (67), Expect = 0.62 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 476 RIGTGPPXEVDGIDKLDI 423 + GTGPP VDGID LD+ Sbjct: 16 KAGTGPPLVVDGIDNLDL 33 Score = 29.9 bits (64), Expect = 1.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 515 LQRRDWENPGV 547 LQRRDWENPGV Sbjct: 97 LQRRDWENPGV 107 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 31.1 bits (67), Expect = 0.62 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +3 Query: 420 FDIKLIDTVDLXGGP 464 F+IKLIDTVDL GGP Sbjct: 52 FNIKLIDTVDLEGGP 66 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 30.7 bits (66), Expect = 0.82 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 426 IKLIDTVDLXGGPG 467 IKLIDTVDL GGPG Sbjct: 40 IKLIDTVDLEGGPG 53 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 30.7 bits (66), Expect = 0.82 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +3 Query: 372 APPTPXXAISLRSGREFDIKLIDTVDLXGGP 464 APP+ +L IKLIDTVDL GGP Sbjct: 31 APPSYDVTFTLGQPNGGLIKLIDTVDLEGGP 61 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.7 bits (66), Expect = 0.82 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 423 DIKLIDTVDLXGGP 464 DIKLIDTVDL GGP Sbjct: 73 DIKLIDTVDLEGGP 86 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 30.7 bits (66), Expect = 0.82 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 423 DIKLIDTVDLXGGP 464 DIKLIDTVDL GGP Sbjct: 95 DIKLIDTVDLEGGP 108 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 0.82 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 423 DIKLIDTVDLXGGP 464 DIKLIDTVDL GGP Sbjct: 40 DIKLIDTVDLEGGP 53 >SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) Length = 166 Score = 30.7 bits (66), Expect = 0.82 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 Query: 423 DIKLIDTVDLXGGP 464 DIKLIDTVDL GGP Sbjct: 152 DIKLIDTVDLEGGP 165 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 30.7 bits (66), Expect = 0.82 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 546 TPGFSQSRRCKXXP 505 TPGFSQSRRCK P Sbjct: 34 TPGFSQSRRCKTTP 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,461,478 Number of Sequences: 59808 Number of extensions: 213842 Number of successful extensions: 5155 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5147 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -