BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0461.Seq (548 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL033514-6|CAA22096.2| 373|Caenorhabditis elegans Hypothetical ... 29 1.7 AL021472-4|CAA16301.1| 149|Caenorhabditis elegans Hypothetical ... 27 6.7 >AL033514-6|CAA22096.2| 373|Caenorhabditis elegans Hypothetical protein Y75B8A.6 protein. Length = 373 Score = 29.5 bits (63), Expect = 1.7 Identities = 22/82 (26%), Positives = 33/82 (40%), Gaps = 1/82 (1%) Frame = -2 Query: 262 SHHEFDVTRCQHXXXXXXXXXXXXXXXXXXXRTRPALSTPDLEPNNNXQRLTYLSIVTQL 83 S FDV R Q+ + P TP + + QR YLS+ +L Sbjct: 229 SQMHFDVKRVQYMTGPPPQMMQQMQMQAPPQQQIPQPQTPQQQVQQHQQRPNYLSVHARL 288 Query: 82 LASAVIPVMSSCVPNVLP-GQL 20 + A V+++ P LP GQ+ Sbjct: 289 MVQAPPQVITAPAPIPLPQGQM 310 >AL021472-4|CAA16301.1| 149|Caenorhabditis elegans Hypothetical protein Y17D7B.4 protein. Length = 149 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -1 Query: 170 PHAPCTQHARPRAEQ*LXTTYL 105 P P TQ A PRAEQ L TTY+ Sbjct: 30 PSQPITQ-ANPRAEQTLMTTYM 50 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,446,887 Number of Sequences: 27780 Number of extensions: 138335 Number of successful extensions: 299 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -