BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0458.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0062 - 4814139-4814176,4814571-4815627 28 6.5 03_05_1016 + 29726949-29727503,29728863-29729504 27 8.6 >10_02_0062 - 4814139-4814176,4814571-4815627 Length = 364 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 342 CENNQTGHVIFMNCLEM-VNMPFDISCYSNYIYGYFINIFA 223 C N+T H++F +++ + PF +S N + G N+ A Sbjct: 142 CSTNETHHILFEQSIKLQPSGPFTLSANDNSLVGVGQNVIA 182 >03_05_1016 + 29726949-29727503,29728863-29729504 Length = 398 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -2 Query: 492 NKWLMLVSSQCMSCSNIXSYF*YSAFXISQSFILA 388 N+W +LVS C+ N + + Y SQSF++A Sbjct: 211 NEWFVLVSESCIPIFNFNTTYRYLQ-NSSQSFVMA 244 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,436,968 Number of Sequences: 37544 Number of extensions: 167165 Number of successful extensions: 195 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 195 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -