BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0458.Seq (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC146825-1|AAI46826.1| 517|Homo sapiens FOXN4 protein protein. 29 9.5 AF425596-1|AAL23949.1| 448|Homo sapiens forkhead/winged helix t... 29 9.5 >BC146825-1|AAI46826.1| 517|Homo sapiens FOXN4 protein protein. Length = 517 Score = 29.5 bits (63), Expect = 9.5 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 187 KPFYYYACLICMC-KNVYKISINII*ITTYVKWHINHF*T 303 KP Y Y+CLI M KN S+ + I +++K H +F T Sbjct: 193 KPIYSYSCLIAMALKNSKTGSLPVSEIYSFMKEHFPYFKT 232 >AF425596-1|AAL23949.1| 448|Homo sapiens forkhead/winged helix transcription factor FOXN4 protein. Length = 448 Score = 29.5 bits (63), Expect = 9.5 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +1 Query: 187 KPFYYYACLICMC-KNVYKISINII*ITTYVKWHINHF*T 303 KP Y Y+CLI M KN S+ + I +++K H +F T Sbjct: 153 KPIYSYSCLIAMALKNSKTGSLPVSEIYSFMKEHFPYFKT 192 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,465,367 Number of Sequences: 237096 Number of extensions: 1101381 Number of successful extensions: 1320 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -