BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0458.Seq (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032632-5|CAA21585.1| 297|Caenorhabditis elegans Hypothetical ... 28 4.4 Z75531-4|CAA99805.1| 408|Caenorhabditis elegans Hypothetical pr... 27 7.7 >AL032632-5|CAA21585.1| 297|Caenorhabditis elegans Hypothetical protein Y11D7A.9 protein. Length = 297 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 6/30 (20%) Frame = +2 Query: 20 FCIKHNLLYTN------YYVKILFSSYYFI 91 FC H+L Y N YY+KILF+S Y + Sbjct: 191 FCHAHSLYYLNPYGRLSYYLKILFTSLYVL 220 >Z75531-4|CAA99805.1| 408|Caenorhabditis elegans Hypothetical protein C54D10.4 protein. Length = 408 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +3 Query: 108 QCLQKSXKNIIMKMKHYKFFLNKYKIKTFLLLCMFNMHVQKCL*NIHKYNLNNN 269 +C+ KS ++ MKMK L IK +L + ++ + N H Y L N Sbjct: 94 KCISKSTESNSMKMKIRTVLLVFVFIKLCILFTVLQETIESIMANDHPYLLGTN 147 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,686,152 Number of Sequences: 27780 Number of extensions: 202165 Number of successful extensions: 353 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -