BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0456.Seq (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A11.04 |||siepin homolog|Schizosaccharomyces pombe|chr 1|||... 26 5.4 SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2... 25 7.1 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 25 7.1 SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce... 25 9.4 >SPAC3A11.04 |||siepin homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 236 Score = 25.8 bits (54), Expect = 5.4 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 450 WPTALLHHAHHQVDPKETGSRLINQLMAHNVPDSCTIHF 566 +PTA + H +DP+ G+ L+ M H+ +S +F Sbjct: 42 FPTAEVRLDHFSIDPRLPGTSLLQIKMPHSPRNSAMGNF 80 >SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 825 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 453 PTALLHHAHHQVDPKETGS 509 PTA HAH +DP E+G+ Sbjct: 223 PTATSWHAHKFLDPAESGA 241 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 25.4 bits (53), Expect = 7.1 Identities = 7/31 (22%), Positives = 19/31 (61%) Frame = +1 Query: 268 EKKMFTICSKSKHKSWVKNIRIETIFIWRIR 360 +KK+ T+ + K + W+ + R I+++ ++ Sbjct: 1546 QKKLVTLAEQDKKRVWICSFRTNEIYLYGLK 1576 >SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1261 Score = 25.0 bits (52), Expect = 9.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 326 SESKPSSFGESVSAPVKITPERMAQEIYDEIKR 424 S +PS++ V A + + R A EI +++KR Sbjct: 1177 SGKEPSTYENMVRAYLSVNDGRKAMEIVEQLKR 1209 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,826,155 Number of Sequences: 5004 Number of extensions: 60075 Number of successful extensions: 157 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -