BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0455.Seq (638 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56399| Best HMM Match : DUF23 (HMM E-Value=1.9e-28) 30 1.8 SB_45633| Best HMM Match : DUF23 (HMM E-Value=3.2e-35) 30 1.8 >SB_56399| Best HMM Match : DUF23 (HMM E-Value=1.9e-28) Length = 419 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Frame = +3 Query: 81 FLLTTLLIYHYRQC-----LQKSYKNIIM--KMKHYKFFLNKYKIKTFLLL 212 +++T +YHYRQC L+ + K++I +MK Y+ L K K L+ Sbjct: 369 WIITEATVYHYRQCAKYEDLENACKSLIFENRMKLYRDLLKKKVAKVLALV 419 >SB_45633| Best HMM Match : DUF23 (HMM E-Value=3.2e-35) Length = 334 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Frame = +3 Query: 81 FLLTTLLIYHYRQC-----LQKSYKNIIM--KMKHYKFFLNKYKIKTFLLL 212 +++T +YHYRQC L+ + K++I +MK Y+ L K K L+ Sbjct: 284 WIITEATVYHYRQCAKYEDLENACKSLIFENRMKLYRDLLKKKVAKVLALV 334 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,895,287 Number of Sequences: 59808 Number of extensions: 262215 Number of successful extensions: 406 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -