BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0455.Seq (638 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62160.1 68416.m06984 transferase family protein low similari... 28 4.5 >At3g62160.1 68416.m06984 transferase family protein low similarity to Taxus cuspidata transferases: 10-deacetylbaccatin III-10-O-acetyl transferase GI:6746554, taxadienol acetyl transferase GI:6978038, 2-debenzoyl-7,13-diacetylbaccatin III-2-O-benzoyl transferase GI:11559716; contains Pfam profile PF02458 transferase family Length = 428 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -3 Query: 348 ENNQTGHVIFMNCLEMVNMPFDISCYSNSYL*YFINIFAH 229 E+ + V F NC +VN P I Y N + I+ +H Sbjct: 266 EDTEVKLVFFANCRHLVNPPLPIGFYGNCFFPVKISAESH 305 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,436,278 Number of Sequences: 28952 Number of extensions: 184800 Number of successful extensions: 226 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 226 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -